CAZyme Information: ODM19826.1

Basic Information

• Species: Aspergillus cristatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus cristatus
• CAZyme ID: ODM19826.1
• CAZy Family: GH43
• CAZyme Description: Glyco_hydro_3 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1E3BHH1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
249	JXNT01000004|CGC11	25830.53	4.9617

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcristatusGZAAS20.1005	10344	N/A	0	10344

• Gene Location: location=JXNT01000004:1188267-1189067(+)

Full Sequence      

MKLHSFALLSTLLGSALASTNSSEGLLKADGVSLGEWQEAYRKASRFVSQLSTAQKILLI
TGNDVNTTDGTFTALQFLDGSMGLQDYFYASAFSQSSALAMTWDSEAMYDQARAVATEFY
LKGIQVVNGPTTQPMGRTVWGGRLVETFGPDPYLNGLVTGLTTKAYVDTGVIAGAKHYIL
NEQETNRTSGGGGGGPGGAGGAPGGMGGSNSSSSSMPPSKRASGGSDSSSNSAPYSSNAD
DKTLHETYL

Enzyme Prediction     

No EC number prediction in ODM19826.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	75	249	1.8e-18	0.5879629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	8.46e-07	88	188	78	178	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	4.28e-06	93	179	88	173	Glycosyl hydrolase family 3 N terminal domain.
185053	PRK15098	0.006	93	180	120	212	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR90780.1|GH3	4.45e-130	1	249	1	247
CAK39741.1|GH3	1.25e-84	1	249	1	217
BCS06883.1|GH3	1.85e-84	1	249	1	257
BCR94274.1|GH3	1.85e-84	1	249	1	257
QMW46605.1|GH3	1.03e-81	1	249	1	215

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4IIB_A	7.04e-29	35	249	19	211	Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIB_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIC_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IIC_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IID_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IID_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IIE_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIE_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIF_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIF_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIG_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIG_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIH_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus],4IIH_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus]
5FJI_A	2.77e-27	29	249	15	212	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus],5FJI_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus]
5JU6_A	5.92e-26	35	249	38	227	Chain A, Beta-glucosidase [Rasamsonia emersonii],5JU6_B Chain B, Beta-glucosidase [Rasamsonia emersonii],5JU6_C Chain C, Beta-glucosidase [Rasamsonia emersonii],5JU6_D Chain D, Beta-glucosidase [Rasamsonia emersonii]
5FJJ_A	1.09e-25	29	249	16	212	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_C Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_D Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae]
6JXG_A	1.86e-23	35	187	4	166	Crystasl Structure of Beta-glucosidase D2-BGL from Chaetomella Raphigera [Chaetomella raphigera]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QPK4|BGLD_ASPNC	3.08e-85	1	249	1	217	Probable beta-glucosidase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=bglD PE=3 SV=2
sp|B8NJF4|BGLD_ASPFN	1.82e-82	1	249	1	215	Probable beta-glucosidase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglD PE=3 SV=2
sp|Q5AUW5|BGLD_EMENI	2.67e-82	1	249	1	274	Probable beta-glucosidase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglD PE=3 SV=2
sp|Q2UNR0|BGLD_ASPOR	9.84e-82	1	249	1	215	Probable beta-glucosidase D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglD PE=3 SV=1
sp|Q0CUC1|BGLG_ASPTN	9.08e-30	35	249	63	254	Probable beta-glucosidase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000222	0.999739	CS pos: 18-19. Pr: 0.9822

TMHMM  Annotations     

There is no transmembrane helices in ODM19826.1.