CAZyme Information: ODM19655.1

Basic Information

• Species: Aspergillus cristatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus cristatus
• CAZyme ID: ODM19655.1
• CAZy Family: GH43
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377	JXNT01000004|CGC17	41989.92	4.7727

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcristatusGZAAS20.1005	10344	N/A	0	10344

• Gene Location: location=JXNT01000004:725161-726409(+)

Full Sequence      

MADSVIARKDAIITTPGSSDYLKVGFFQTAVLRALDYHETTESACADTQTDWEEYLVFSS
EGLLPYLTNATRDTGYPLDRFATGDGLTHLYDKSQNTTIKNALRALRESANLQPRNQYGG
YWFYTYPNWSYLDGTYSLLPFLVDYTQRFDPGNAAAVSGDVMHQLELLWAHCQDQGTTGS
GLLVHGYDSTKKASWANPVTGGSPYVWSRALGWYFMALVDVFDIVRSHDIFPSELESYIR
QRYTELAKAVLSAADKDNGCWWQVVTLPRAKGNYIETSGSGMLVYGLLKGSRLGLLSPEE
EYTGVAEKCYNHMLREYVVDEGNGLLGFNGTVGVCSLNSSATYEYYVSVPVTYNSLHGIA
AFTLASLEHEMRSNQVL

Enzyme Prediction     

No EC number prediction in ODM19655.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	25	370	3.4e-68	0.9427710843373494

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	1.60e-42	1	370	19	354	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	5.79e-42	76	372	70	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR90601.1|GH105	5.43e-274	1	377	1	377
QRD85043.1|GH105	5.25e-150	1	374	45	420
UDD61061.1|GH105	9.87e-148	1	374	45	420
BAE63195.1|GH105	7.80e-146	1	374	45	415
QMW45474.1|GH105	1.34e-143	1	374	543	918

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	2.08e-43	1	370	8	359	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	2.15e-32	78	370	87	365	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	9.21e-32	78	370	77	355	Chain A, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34559|URHG2_BACSU	1.11e-31	78	370	87	365	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	1.62e-27	139	368	3	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	1.62e-27	139	368	3	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000015	0.000021

TMHMM  Annotations     

There is no transmembrane helices in ODM19655.1.