CAZyme Information: ODM19583.1

Basic Information

• Species: Aspergillus cristatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus cristatus
• CAZyme ID: ODM19583.1
• CAZy Family: GH43
• CAZyme Description: Mannan polymerase II complex ANP1 subunit

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
468	JXNT01000004|CGC4	53042.82	5.4621

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcristatusGZAAS20.1005	10344	N/A	0	10344

• Gene Location: location=JXNT01000004:543961-545556(+)

Full Sequence      

MDRHKALMSGYPAYPRGQSSYRFQPRPQTALRRRRQLINRLILLGGVSLFISILIFPSWR
AAILPTLTLGLLSSGEDLQLQTVRHYDLSAVQGSGNGWEHGERVLLCTPLRDATAHLPMF
FSHLRNLTYPHNLIDLAFLVSDSKDGTLGMLEEMLEEMQTDPDPGMTFGEISVIQKDFGQ
QVTQDFESRHGFAAQAGRRKRMGQARNWLLTATLRPTHSWVYWRDADVETAPATIIEDLM
RHDKDVIVPNVWRPLPDWLGGEQPYDLNSWQESETALALAESLDEDAVIVEGYAEYATWR
PHLAYLRDPFGDPEMEMDLDGIGGVSILAKAKVFRAGVHFPAFSFERHAETEAFGKMARR
MGFSVVGLPHYTIWHLYEPSVDDLKHMEELAHEQEQREKEKEEEARQNERVNSLFQDPKS
QWEVDGAVVHDAVMKEQKQDPKNAKAQKGSGEGPAASPVKESTGAERQ

Enzyme Prediction     

No EC number prediction in ODM19583.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	81	344	9.6e-123	0.9888059701492538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	2.78e-160	82	344	1	265	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR90524.1|GT62	0.0	1	468	1	468
QRD89585.1|GT62	8.45e-248	1	447	1	458
UDD59518.1|GT62	1.02e-247	1	447	1	458
CAK42575.1|GT62	2.78e-247	1	459	1	475
BCS13588.1|GT62	3.88e-246	1	464	1	478

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	1.04e-61	83	380	6	304	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32629|ANP1_YEAST	1.13e-161	82	422	61	401	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|O74745|ANP1_SCHPO	3.15e-149	83	430	77	424	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|P23642|VAN1_YEAST	5.10e-126	82	385	171	521	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|Q00314|VAN1_CANAX	1.45e-121	76	390	69	433	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P53697|MNN9_CANAL	7.73e-66	76	378	66	368	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999880	0.000122

TMHMM  Annotations     

Start	End
41	63