CAZyme Information: ODM19367.1

Basic Information

• Species: Aspergillus cristatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus cristatus
• CAZyme ID: ODM19367.1
• CAZy Family: GH35
• CAZyme Description: Lysozyme [Source:UniProtKB/TrEMBL;Acc:A0A1E3BEL7]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
159	JXNT01000005|CGC1	16782.98	4.0607

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcristatusGZAAS20.1005	10344	N/A	0	10344

• Gene Location: location=JXNT01000005:2292102-2292734(+)

Full Sequence      

MSPSKAVLAFIPVLAFIPALAIAVAACTGPPVNISTLDLLKGFETMEPDPYDDGFETRPS
ATSAQDAVSNALTDTVTLNDNQYGALVSWTFNAGNGNMEYSNLVRRMNGGEDVVAVANDE
LPLWNKANGKVINGLVWGRKAEVDLFNAPSNVGALPVPC

Enzyme Prediction     

No EC number prediction in ODM19367.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	63	142	3.6e-18	0.5474452554744526

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
381599	lyz_endolysin_autolysin	1.50e-29	37	147	2	136	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
381619	endolysin_R21-like	3.02e-15	75	142	72	137	endolysin R21-like proteins. Unlike T4 E phage lysozyme, the endolysin R21 from Enterobacteria phage P21 has an N-terminal SAR (signal-arrest-release) domain that anchors the endolysin to the membrane in an inactive form, which act to prevent premature lysis of the infected bacterium. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
381620	lyz_P1	1.77e-14	35	142	5	135	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
226295	RrrD	6.37e-14	37	146	12	147	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
395766	Phage_lysozyme	2.55e-07	78	136	48	103	Phage lysozyme. This family includes lambda phage lysozyme and E. coli endolysin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW42435.1|GH24	1.11e-50	26	159	18	183
QMW30363.1|GH24	1.11e-50	26	159	18	183
BAE59613.1|GH24	1.11e-50	26	159	18	183
QRD86847.1|GH24	1.11e-50	26	159	18	183
UDD62117.1|GH24	1.11e-50	26	159	18	183

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ET6_A	1.60e-10	75	146	124	193	Chain A, Lysozyme [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P07540|ENLYS_BPPZA	3.09e-10	66	152	66	150	Endolysin OS=Bacillus phage PZA OX=10757 GN=15 PE=3 SV=1
sp|P11187|ENLYS_BPPH2	4.26e-10	66	152	66	150	Endolysin OS=Bacillus phage phi29 OX=10756 GN=15 PE=1 SV=1
sp|Q37896|ENLYS_BPB03	1.58e-06	76	146	74	142	Endolysin OS=Bacillus phage B103 OX=10778 GN=15 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000020	1.000008	CS pos: 26-27. Pr: 0.9689

TMHMM  Annotations     

Start	End
7	29