CAZyme Information: ODM19350.1

Basic Information

• Species: Aspergillus cristatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus cristatus
• CAZyme ID: ODM19350.1
• CAZy Family: PL1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
483		54716.27	5.5434

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcristatusGZAAS20.1005	10344	N/A	0	10344

• Gene Location: location=JXNT01000005:2234723-2236174(+)

Full Sequence      

MLLKPGERSSVGGSWAGKRLIRFGVAFLLVGAFTLFLWPPFPPSHIQAQTPSANISIASG
IHCELDLGVLERLHVNKLGSYLRREVNAVTLAANQEVPMKQRLDTPLMDRKLLDPNEQLT
EEQSQADCSMPHPLTVQVPLPPKTVDASHIDFGVATRADRLNDSLDQFAHWAGYTRTRIF
ALVEPDKRVPEVQAKADSLGINLYITESDEEYQSRYFSLVRHLASHVRAQTRWSVVIDDD
TFFMSMSALVQALEKHDHTQMIYLGGISESIPQVGAFGVMAFGGAGVFLSRPLAVELSKP
EIFEQCQNMEFTGDRRISLCIYQYTPAKLTIDHRLRQLDMMGDVTGFFETGRELPLSVHH
WKSWFHADMPKVATISELCGDTCLLRQWWFADGWLLTNGFSVVKYSTDVDPFDKTMELTW
ESHNGAVHESYLHELGPLRPKDWDKISYLLEDAVVEDDQVRQFYIHRGGKDGDEILELVW
RNA

Enzyme Prediction     

No EC number prediction in ODM19350.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215605	PLN03153	1.97e-12	232	360	212	341	hypothetical protein; Provisional
367085	Fringe	4.63e-08	232	298	86	160	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
398362	DUF604	1.42e-05	280	360	9	90	Protein of unknown function, DUF604. This family includes a conserved region found in several uncharacterized plant proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR85752.1|GT31	0.0	1	483	1	483
BAE58287.1|GT31	7.45e-231	1	481	1	483
UDD56605.1|GT31	7.45e-231	1	481	1	483
QMW40633.1|GT31	4.29e-230	1	481	1	483
QRD83076.1|GT31	2.47e-229	1	481	1	483

PDB Hits     

ODM19350.1 has no PDB hit.

Swiss-Prot Hits     

ODM19350.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.356334	0.643659	CS pos: 48-49. Pr: 0.5391

TMHMM  Annotations     

Start	End
20	42