CAZyme Information: ODM19053.1

Basic Information

• Species: Aspergillus cristatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus cristatus
• CAZyme ID: ODM19053.1
• CAZy Family: GH31
• CAZyme Description: GMC_OxRdtase_N domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1E3BDK4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
579	JXNT01000005|CGC9	64526.41	5.7281

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcristatusGZAAS20.1005	10344	N/A	0	10344

• Gene Location: location=JXNT01000005:1349937-1351676(+)

Full Sequence      

MVKNGPYFDFVVVGGGTAGSTVAGRLAENPNVTVLIVEAGVGNPLEVEEITTPSSAMDLR
NSKHDWAYKTTMVKRDDYERIEKPNTRGKALGGSSSLNYFTWVPGCKPTFDMWEEYGGKE
WTWDPLVPYLRKSATYHDDRGLYETDLSKIGAGGPIHISHAELLDEMEPFRDAVTKAWTS
RGHPLTENIYDGEMIGLTHCCDSIYKGVRSGSFLFVQDKPNITILPQVHSKKLIIDEADR
VCKGVTVTDPSGNELKFYASREVILSQGVFETPKLLMLSGVGPFRELAKHGIDTVIDSRH
VGQHLIDHPGVPFVLRVKDGYGMDDHLLRKGPQNDATIQAYKKNRTGPAASGLLELVGFP
RIDDYLEKDEEYRKVKAANGGKDPFSPYGQPHFELDFVCMFGSAFQWHYPVPKQGNYLTV
VVDLVRPISEPGEVTLNSADPLVQPNINLNFFANDLDIIAMREGIRFSYDVLTKGDGFKD
LVVDEYPWEMPLDSDEEMKRAVLDRCQTAFHPCGTARLSKSIDQGVVDPKLKVHGIKNLR
IADASVVPVIPDCRIQNSIYMIGEKCADLLKADHKDLFK

Enzyme Prediction     

No EC number prediction in ODM19053.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	8	573	1.2e-146	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	6.47e-87	8	575	8	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	6.98e-81	8	569	6	530	choline dehydrogenase; Validated
398739	GMC_oxred_C	5.48e-41	427	566	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.10e-20	87	309	23	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	2.24e-17	8	563	56	569	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR85434.1|AA3_2	0.0	1	579	1	579
UDD59638.1|AA3_2	0.0	1	578	1	578
QMW42855.1|AA3_2	0.0	1	578	1	578
UPL02484.1|AA3_2	0.0	1	578	1	578
QRD89697.1|AA3_2	0.0	1	578	1	571

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ZU2_A	0.0	4	578	3	577	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
3Q9T_A	0.0	4	578	3	577	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	0.0	4	578	3	577	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	1.22e-68	8	573	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	6.57e-68	8	573	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q988C9|4PADH_RHILO	1.66e-58	8	570	7	533	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|M5EAX2|GMCH_MALS4	8.90e-56	4	570	43	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	8.90e-56	4	570	43	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|Q7X2H8|CHOX_ARTGO	8.95e-56	8	572	14	528	Choline oxidase OS=Arthrobacter globiformis OX=1665 GN=codA PE=1 SV=1
sp|Q0R4L2|PDH3_LEUMG	4.43e-54	8	570	41	595	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000003

TMHMM  Annotations     

There is no transmembrane helices in ODM19053.1.