CAZyme Information: ODM18652.1

Basic Information

• Species: Aspergillus cristatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus cristatus
• CAZyme ID: ODM18652.1
• CAZy Family: GH20
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
450	JXNT01000005|CGC9	47107.22	4.3149

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcristatusGZAAS20.1005	10344	N/A	0	10344

• Gene Location: location=JXNT01000005:228629-230089(-)

Full Sequence      

MRFDMTSSRAFAVLCLLAGAEAAHHNHHAHDHIHSDGKVKESLVKKSGKCKFPSDAGLVA
ITPGAVNEGWAMSPDESCTPGNYCPYACPPGQMSMQWDPKATSYSYPMSMNGGLYCDEDG
EIQKPFPDRPYCQDGTGAVGVQNKCRSPVSFCQTVLPGNEAMLIPTLVNELATLAVPDPD
YWCETSAHFYINPPGVQSEIACAWGTSSNPYGNWSPYVVGANTDKDGRTFVKLGWNPVYL
EPATPFRNIVPDFGAEIQCEGGNCEGLPCKIDPSINDVNEITGETTTDGAGGGSFCVVTV
PKGEKANIVVWEKDFIGGDDDTSSTTVAIPTSTASSTSSTSTSSSSSTSSTASTTTQQPS
NTPFLSLNLGISIGMSTSVRSASASYTYEPHVFIESGTAAAVSATPAVQTASPSPSTAQD
STEDSDSGAATTTVSLFVVVLGVCAAVLQL

Enzyme Prediction     

No EC number prediction in ODM18652.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH132	31	308	1.2e-90	0.8844884488448845

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397780	SUN	6.75e-114	45	297	1	244	Beta-glucosidase (SUN family). Members of this family include Nca3, Sun4 and Sim1. This is a family of yeast proteins, involved in a diverse set of functions (DNA replication, aging, mitochondrial biogenesis and cell septation). BGLA from Candida wickerhamii has been characterized as a Beta-glucosidase EC:3.2.1.21.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR86552.1|GH132	9.63e-268	1	450	1	449
BAE60652.1|GH132	1.37e-170	1	313	1	313
EAL90726.1|GH132	1.12e-169	1	313	1	316
CAF32103.1|GH132	1.12e-169	1	313	1	316
QRD89836.1|GH132	5.19e-169	1	313	1	313

PDB Hits     

ODM18652.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q04018|YM79_YEAST	1.08e-110	44	312	45	318	Uncharacterized protein YMR244W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YMR244W PE=3 SV=1
sp|O74851|ADG3_SCHPO	1.04e-93	34	310	57	333	Probable secreted beta-glucosidase adg3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=adg3 PE=2 SV=1
sp|Q9UR09|PSU1_SCHPO	2.30e-28	52	264	172	389	Probable secreted beta-glucosidase PSU1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=psu1 PE=3 SV=1
sp|P46955|NCA3_YEAST	2.15e-27	36	264	78	308	Beta-glucosidase-like protein NCA3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NCA3 PE=3 SV=1
sp|B3LRC2|UTH1_YEAS1	2.96e-26	52	295	116	359	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain RM11-1a) OX=285006 GN=UTH1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000294	0.999676	CS pos: 22-23. Pr: 0.9761

TMHMM  Annotations     

There is no transmembrane helices in ODM18652.1.