CAZyme Information: ODM18575.1

Basic Information

• Species: Aspergillus cristatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus cristatus
• CAZyme ID: ODM18575.1
• CAZy Family: GH2
• CAZyme Description: Chitinase [Source:UniProtKB/TrEMBL;Acc:A0A1E3BC78]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1393	JXNT01000006|CGC7	151133.17	4.6507

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcristatusGZAAS20.1005	10344	N/A	0	10344

• Gene Location: location=JXNT01000006:1366784-1371276(+)

Full Sequence      

MSSPWIRVALGAYGLLISADIVSGNPGLKLSASPGYRNSDVCPQRCNVVGPNPANWSAYR
NLEQFDACPLAVFQAFSIYDNVDDASRPHGIYACSSYGPDFANMPKSSVQASTVESINAT
YEVGWWDDGRNIAVADIRSAAKQLRQYLAGGYGSTNTTEFLYARSGRAAVGLYVGQGLQN
EGVSAVALKTLEDNLSALNASSRSVAMQFCQPDYTGEHIFGPLLLSSKPSSLGLSFPNSQ
NFSGQAMLTSRIVTTSESNTTVAGANSTSFTAVKRSSQVKLHARSECSTIQVHSGDSCGS
LAKKCGISGNDFTKYNNDDDLCSSLAPGQHVCCSKGDLPDFRSKPNADGSCHVYYVPKGE
NCAKIAAANSLTNDDLEEFNKKTWAWNGCENLQYNMNICLSKGDPPMPASLSNAVCGPQV
PGTKRPTDGTKLADLNPCPLNACCDVWGQCGITAEFCTDTGTGNPGTAEPGTNGCISNYG
TNIVRGDAPSTFRKIAYYEGYGLKRDCLFQDVLQIDGSKYSHLHFAFGTLTQDYQVEVGD
VLSSTYNIFREGVTPANRMKMAQSIASFIKDNDLDGVDIDWEYPGAPDIPGIPAGSKDDG
DNYLAFLVILKNLLPGKSVSIAAPSSYWYLRAYPLKKIAKVVDYIVYMTYDLHGHQVNLT
ETMSSLVMITKAEVPSNKVVVGITSYGRSFNMAEAGCYGPECLYTGSRMQSDAIKGRCTD
TAGYISDAEIREIMNNKSRVTKHFVDTESNSNILVYDDRQWVSYMDDDIKAHRHQLYSAL
NMGGTTNWATDLEKYNDVPRPSDSWLDFKLSIKAGKNPWQAGDRNGNWTDLTCDSQAAAD
IRHLSPSDRWEQMDCVDAWKNIIDVWKNIDRPDSHFYFTESISLTINGPPHADCGSLLDK
NNCGQTLQCDGFQNAGSGPAGWVIWNSFVMIHEMYQSYHDALYKAAASAINPALEDFENK
FTPIPPEQDNTWLLLLLDLVTLPYFIEKTDAADNIKDLTMLAIGQSTTIAKDLLSTSESD
WNEESQDEFSNYLGQTITAWGNITSVALERLFNGKDKNIATLHAILADGKLLSGGGDEIN
TSPPETSEADLEANIAKAFFAYAIPSAWTFSKHYAFIIDSGYDCGTTDPLGDYLDTDTMH
ATYGCYGGKLYYLAAPKGDSTECHCQYIKSHCERVCSDAHFSAPPGLDSLDGKNFGGVTV
QDLIQGSVRTYQQNGNENGGKFVDVTNGGSFDDLMASDVMTPGFIRLPVCSPEHAYKSWH
TAGPGDDPTYPCNTAKGPDRCQSSSFVDQTSDTSPPVSDCKQIIKNIQGDGGATWTTGIS
GQRELVSFGECKFGVESKSGADGNVTFKVGAQDIIDIINEAIKRFGGGGKVGAKGQVDCD
GNVHDTTIEWGIY

Enzyme Prediction     

EC	3.2.1.14:3	3.2.1.14:3	3.2.1.14:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	493	796	7.6e-44	0.9425675675675675

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119357	GH18_zymocin_alpha	1.97e-150	493	793	1	345	Zymocin, alpha subunit. Zymocin is a heterotrimeric enzyme that inhibits yeast cell cycle progression. The zymocin alpha subunit has a chitinase activity that is essential for holoenzyme action from the cell exterior while the gamma subunit contains the intracellular toxin responsible for G1 phase cell cycle arrest. The zymocin alpha and beta subunits are thought to act from the cell's exterior by docking to the cell wall-associated chitin, thus mediating gamma-toxin translocation. The alpha subunit has an eight-stranded TIM barrel fold similar to that of family 18 glycosyl hydrolases such as hevamine, chitolectin, and chitobiase.
214753	Glyco_18	9.33e-43	493	792	1	333	Glyco_18 domain.
395573	Glyco_hydro_18	4.52e-37	493	791	1	305	Glycosyl hydrolases family 18.
119365	GH18_chitinase	7.07e-32	554	691	106	267	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
119349	GH18_chitinase-like	6.80e-28	494	652	1	178	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA32694.1|CBM18|GH18	0.0	1	1393	2	1484
AEO70565.1|CBM18|CBM50|GH18	0.0	9	1393	6	1480
BCS24215.1|CBM18|GH18	0.0	1	1393	2	1477
AIT18887.1|CBM18|GH18	0.0	1	1393	1	1458
UQC75374.1|CBM18|GH18	0.0	1	1393	1	1443

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Y29_A	1.95e-17	490	797	5	355	Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 [Ostrinia furnacalis],5Y2B_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with HEPTA-N-ACETYLCHITOOCTAOSE (NAG)7 [Ostrinia furnacalis]
6JAV_A	2.22e-17	490	797	5	355	Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a piperidine-thienopyridine derivative [Ostrinia furnacalis],6JAW_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a napthalimide derivative [Ostrinia furnacalis],6JAX_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with chitooctaose [(GlcN)8] [Ostrinia furnacalis],6JAY_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a dipyrido-pyrimidine derivative [Ostrinia furnacalis]
6JM7_A	1.76e-14	543	798	89	355	Crystal structure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis],6JMB_A Chain A, ofchtiv-allosamidin [Ostrinia furnacalis]
6KST_A	8.32e-14	486	788	1	352	Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
3WL1_A	1.33e-13	556	798	104	364	Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with reaction products (GlcNAc)2,3 [Ostrinia furnacalis],3WQV_A Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with a(GlcN)5 [Ostrinia furnacalis],3WQW_A Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with a(GlcN)6 [Ostrinia furnacalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P09805|KTXA_KLULA	1.44e-86	302	803	205	722	Killer toxin subunits alpha/beta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 PE=1 SV=1
sp|P36362|CHIT_MANSE	2.12e-14	556	798	120	380	Endochitinase OS=Manduca sexta OX=7130 PE=2 SV=1
sp|Q13231|CHIT1_HUMAN	1.78e-12	554	795	112	365	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
sp|Q9W5U2|CHI10_DROME	8.05e-12	555	798	1504	1758	Probable chitinase 10 OS=Drosophila melanogaster OX=7227 GN=Cht10 PE=2 SV=2
sp|Q5RBP6|CH3L1_PONAB	1.29e-11	557	795	142	386	Chitinase-3-like protein 1 OS=Pongo abelii OX=9601 GN=CHI3L1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000237	0.999717	CS pos: 24-25. Pr: 0.9772

TMHMM  Annotations     

There is no transmembrane helices in ODM18575.1.