CAZyme Information: ODM17857.1

Basic Information

• Species: Aspergillus cristatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus cristatus
• CAZyme ID: ODM17857.1
• CAZy Family: PL26
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
467		53277.18	5.7104

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcristatusGZAAS20.1005	10344	N/A	0	10344

• Gene Location: location=JXNT01000007:539089-540553(+)

Full Sequence      

MFNRWKSAILVYAVLLFIVGTALFHKLDKDDSFSPPSIFNNNAAAVATEEGPDFWEWETK
TRFSSKKHEKDRICESFPAQILSQVQVVLKIGASEPADRVDAQISTVTRCISNLLVVSDM
ESELHGHHVHDVLADLPESVWTNKADLEAYLALKQGNTKAVNGQQGWNLDRMKFLPMVER
AYDVNPTAKWYVFLESDTYYVWDNLFRLLDQYDPTVPLYFGSPSPGKPTAEETTWFAYGG
SGFIISTAAMQKLVYRKTGAYGEYIQPSLSAQYEDIIRGTDCGDTVIGWALYEKGVKLSG
LWPMFNAHALHSIPFDEMHWCRPVISMHKTKLADMEGLIRWENERDRTYPLLYADLFNYT
GMGTFNHRSDWDNADWGGWQEPPESPAHTSLNACGAACHDNADCLSYTYSSTGHCFFIRT
MRLGDKRPLNLEERQIAGWDLQKMQNWIANHQCEKAQWVKPSLSRIF

Enzyme Prediction     

No EC number prediction in ODM17857.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367085	Fringe	2.23e-08	189	329	86	226	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
215605	PLN03153	6.59e-05	186	246	209	270	hypothetical protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR88525.1|GT31	0.0	1	467	1	467
BCR85810.1|GT31	1.01e-303	1	467	5	485
UDD57328.1|GT31	4.22e-224	3	467	7	477
QMW44383.1|GT31	3.44e-223	3	467	7	477
BAE62206.1|GT31	9.84e-223	3	467	7	477

PDB Hits     

ODM17857.1 has no PDB hit.

Swiss-Prot Hits     

ODM17857.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.968970	0.031042

TMHMM  Annotations     

Start	End
7	24