CAZyme Information: ODM16921.1

Basic Information

• Species: Aspergillus cristatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus cristatus
• CAZyme ID: ODM16921.1
• CAZy Family: CE4
• CAZyme Description: Probable glucan endo-1,3-beta-glucosidase eglC [Source:UniProtKB/TrEMBL;Acc:A0A1E3B812]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
308	JXNT01000010|CGC1	33503.38	4.6364

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcristatusGZAAS20.1005	10344	N/A	0	10344

• Gene Location: location=JXNT01000010:643334-644451(+)

Full Sequence      

MRVSGLLPALLAALPAAATSNDGRGLLGLALGNQNADGSCKATSDYKADFDAIKSVTTLV
RTYSASNCDTAKNIIPAAKEKGFKVVLGVWPDYDQSFNEDFDALKSTVHGNEDVVRAITV
GSEVLYRGGLTAEQLLNRIQQVQKEFPDMSVGFVESWNKLNDGSADPILQGGVNYVLANG
FAYWQNTPIDSAPKTYFDDMSQAMKHVQQAAGDNAKNIRFGNGETGWPTDGGSDYGEAKA
GTKNAEQYWKQGVCGMLAWGVDVFYFEAFDESWKPLSKGDNGQMMDETHWGLFTADRKLK
FDISCPKN

Enzyme Prediction     

No EC number prediction in ODM16921.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	28	305	1.1e-42	0.9935691318327974

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	3.13e-63	35	297	54	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	2.01e-44	35	305	11	309	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR86239.1|GH17	2.60e-228	1	308	1	308
CAK45395.1|GH17	2.56e-160	1	305	1	301
BCS09817.1|GH17	2.40e-156	1	305	1	302
BCR97352.1|GH17	2.40e-156	1	305	1	302
QMW46467.1|GH17	5.19e-156	1	306	1	303

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	8.68e-31	37	304	46	293	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	6.37e-30	37	304	46	293	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B2W4|BGL2_ARTBC	4.87e-122	1	308	1	304	Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02797 PE=1 SV=1
sp|P15703|BGL2_YEAST	8.52e-73	1	305	1	310	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|Q5AMT2|BGL2_CANAL	5.28e-70	19	308	14	308	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2
sp|P43070|BGL2_CANAX	5.96e-69	19	308	14	308	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1
sp|O13990|BGL2_SCHPO	2.75e-61	25	305	40	318	Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bgl2 PE=2 SV=4

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000266	0.999724	CS pos: 18-19. Pr: 0.9846

TMHMM  Annotations     

There is no transmembrane helices in ODM16921.1.