CAZyme Information: ODM16382.1

Basic Information

• Species: Aspergillus cristatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus cristatus
• CAZyme ID: ODM16382.1
• CAZy Family: AA9
• CAZyme Description: Glyco_hydro_15 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1E3B5Z8]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
292		33445.26	6.7825

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcristatusGZAAS20.1005	10344	N/A	0	10344

• Gene Location: location=JXNT01000012:586468-587450(-)

Full Sequence      

MELSHLEGYRGSSPVRIGNAPTGHIQQDIYGALFDSIYLYNKHVGPISYDQWRAIRSTVN
RVRKLHKTPDMSIWEVRGEKQHFVYSKIMLWVTFDRAIRLAEKRSNLPCPELIEWRTTRD
EIYEDVMEHGYNMDGGFFSMSYENKKIMDASVLIAPLVFFIAPDDPRLLSTIKNILQSPE
VGGLTTAKMVLRYDHAIAHDGLDGKEGAFIMVTFWLVEAMGRASMAKKHLHEYPHLKEMH
SNAFSYFENVLVFANHLGMFSEEVNHSGEQMGNTPQAFSHISCISAAMNLER

Enzyme Prediction     

No EC number prediction in ODM16382.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH15	20	287	3.3e-52	0.7285318559556787

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225922	SGA1	1.80e-62	5	291	340	605	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family [Carbohydrate transport and metabolism].
395586	Glyco_hydro_15	2.62e-51	5	287	102	416	Glycosyl hydrolases family 15. In higher organisms this family is represented by phosphorylase kinase subunits.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR86680.1|GH15	2.97e-154	1	224	388	611
BCS16993.1|GH15	1.47e-127	1	290	385	674
BCS05439.1|GH15	1.47e-127	1	290	385	674
BCR92693.1|GH15	1.38e-124	1	292	395	680
QQK45555.1|GH15	3.04e-124	1	292	389	674

PDB Hits     

ODM16382.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10211|YAY3_SCHPO	3.78e-95	1	292	359	641	Uncharacterized protein C4H3.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4H3.03c PE=4 SV=1
sp|P71741|TREH_MYCTU	4.62e-54	2	292	394	662	Trehalase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2402 PE=1 SV=2
sp|A0R0W9|TREH_MYCS2	7.47e-51	2	292	382	650	Trehalase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=MSMEG_4535 PE=1 SV=1
sp|Q978S7|TREH_THEVO	5.91e-50	7	291	350	611	Trehalase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) OX=273116 GN=TVG1381191 PE=1 SV=1
sp|Q9HLE2|TREH_THEAC	8.99e-49	6	291	307	569	Trehalase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) OX=273075 GN=Ta0286 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000071	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ODM16382.1.