CAZyme Information: ODM15389.1

Basic Information

• Species: Aspergillus cristatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus cristatus
• CAZyme ID: ODM15389.1
• CAZy Family: AA6
• CAZyme Description: putative pectine lyase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
457		47709.55	4.6788

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcristatusGZAAS20.1005	10344	N/A	0	10344

• Gene Location: location=JXNT01000017:388797-390282(-)

Full Sequence      

MAFFRSLLATTALLSAYSNAEGVQGTAFGFASGTTGGGDASPAAPSDIAELKSWLSDDTP
RVILIDKEFNFLGTEDTCDDCECCIPDSNSCGSSGQNAIKTDGSDWCGNYPTTTCTYDNA
GLEGLTVASDKSIVGVGSAGVLRGKGLRLTSGVENIIIQNIHITELNPQYIWGGDAITLD
GTDKIWIDHVKVSLVGRQMFVSGYDSSGSVTISNSEFDGRTSWSASCDGHHYWSVLGYGK
NDKVTFANNYIHHTSGRSPKVEFANHWHAYNNYWYNNTGHAFDVGENSNVLIEGNVFAQV
DTPSEPDSGKVFAVTSSDQSACKSALGRNCVANSLVSSGNLTTSDQSVLSNWPSDEGKAD
VMDVSKVASYVVANAGVGKLGGSASASSTVGAASSATPSASASMVKRFGLPFVPAYSQAG
PGTSSMPALPSFTWKTVGTPKPTLPAPAGFGSQPQAF

Enzyme Prediction     

EC	4.2.2.10:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	114	298	1.5e-91	0.9893048128342246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	7.02e-54	116	297	5	186	Amb_all domain.
226384	PelB	1.59e-28	125	380	97	344	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	2.18e-19	127	297	32	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.
404168	Beta_helix	0.006	175	297	1	110	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR84521.1|PL1_4	0.0	1	457	1	457
CAK48551.1|PL1_4|4.2.2.10	8.36e-226	1	456	1	463
CAD34589.1|PL1_4|4.2.2.10	8.36e-226	1	456	1	463
AIX03726.1|PL1_4|4.2.2.10	9.35e-225	1	456	1	462
BCS01807.1|PL1_4	1.88e-224	1	456	1	462

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IDK_A	4.00e-106	22	380	2	359	Pectin Lyase A [Aspergillus niger]
1IDJ_A	1.45e-103	22	380	2	359	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1QCX_A	2.39e-96	22	379	2	359	Pectin Lyase B [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8NJK6|PELF_ASPNG	1.48e-226	1	456	1	463	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1
sp|A2R6A1|PELF_ASPNC	1.48e-226	1	456	1	463	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1
sp|Q2UJA7|PELF_ASPOR	3.60e-213	1	400	1	404	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2
sp|B8N316|PELF_ASPFN	1.46e-212	1	402	1	404	Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelF PE=3 SV=1
sp|Q0CZD4|PELF2_ASPTN	2.45e-190	1	438	1	443	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000759	0.999205	CS pos: 20-21. Pr: 0.9760

TMHMM  Annotations     

There is no transmembrane helices in ODM15389.1.