CAZyme Information: ODM14530.1

Basic Information

• Species: Aspergillus cristatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus cristatus
• CAZyme ID: ODM14530.1
• CAZy Family: AA11
• CAZyme Description: Sialidase domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1E3B0Q4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373		40974.60	7.1011

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcristatusGZAAS20.1005	10344	N/A	0	10344

• Gene Location: location=JXNT01000024:45698-46819(+)

Full Sequence      

MADKIGQKILHGFQKGLDELKNQGSSGSSHPATNHPGAPTIGRRVINSDERHVSFNGRGT
YPRLTRLSDGSILASCTQFEGSTRVLRVSRSTDGGQSWAEHGEVSRADGDCDNVFLLEAA
PGVILAAFRNHDIGPHGPTHFRITVCRSTDGGRSWQFASQAMEKGPPNGIWEPFMRKGRG
GEVQLIYSQEFAHNNQCSMMVTSTDHGSSWSPPRCLHGETECLRDGMTGIAETRDNGREA
LVMVFETTRHGPFNVEALLSYDDGRTWGWRQNVYTPARGHNCGSPQIASFADGTLAVIFM
TDESQSQVQWTRNATVSVVFGQAPHNGQIQWSRPEVVCDKISHWPGIMALDHHTLLAAYE
CGGPRARTISWHP

Enzyme Prediction     

No EC number prediction in ODM14530.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH93	58	334	3.5e-74	0.9478827361563518

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271234	Sialidase_non-viral	4.57e-15	62	364	17	327	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	1.00e-09	51	306	142	329	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
404074	BNR_2	7.75e-04	70	268	1	199	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
404074	BNR_2	0.010	62	169	165	264	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR91132.1|GH93	9.35e-273	1	373	1	373
EAA62412.1|GH93	3.33e-165	1	370	1	365
QMW42642.1|GH93	1.73e-158	1	372	1	379
QMW30589.1|GH93	1.73e-158	1	372	1	379
QRD89469.1|GH93	1.73e-158	1	372	1	379

PDB Hits     

ODM14530.1 has no PDB hit.

Swiss-Prot Hits     

ODM14530.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ODM14530.1.