CAZyme Information: OCF70295.1

Basic Information

• Species: Kwoniella mangrovensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella mangrovensis
• CAZyme ID: OCF70295.1
• CAZy Family: GT90
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
865		96474.98	5.4244

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KmangroviensisCBS8507	8555	1296122	133	8422

• Gene Location: location=KI669472:1205691-1208616(+)

Full Sequence      

MASKTNDQMDRSFLTASIPKLLEEMTEEEKISLLAGKDWWNTVPVPRLNIPSIKVTDGPN
GARGDSFYHMCPATALPNATCLGATFSTELAELSGSLLADEARARNASCLLAPTINIQRS
PLGGRAFESYAEDPTLSGLIAASYVNGLQDKGVSATIKHFVANDQEHERMGQDSIIASRP
LRDIYLRPFQLAQKHSKPWAFMTAYNKLNGTHCSENKWLLTDVLRGEWKFDGLVMSDWYG
TYSVSDSVNAGLNLEMPGEARWRQQTLIAHSIYSHKIDPRTLDKRVSEIMNWVQKLAQHN
EELVYAKPNKEKTRIEEKEADAKILRRIGGEGIVLLKNDQDVLPLNRPNTKVGVIGPNAK
AKVLTGGGSAQLRASWSVSPWEGLVHNKPDDVDLSYSLGATTSKYLPLLGEEFTTLDGKP
GFDLRHYAINKESGEKEENPVLTEQRDTSDMFMADFHPPELGDQYFTELLAIFTPGESAE
WVFESTVTGQAWLWIDDDLIIDNSKYTSRGTSYFGSGSVPLQRTFKVETGKSYNIRYLHD
SRIPSTLITAGSTPLTVVGIRLGAFPKFEPEQAIKDAVELAKNVDVPLIIAGLNADWESE
GYDRPDLSLPLRTNELISRVAEANPKTVIVIQAGSAVSMPWIDQVSGVVYAWYGGNECGN
AIADIIYGKVNPSGRLPITFPVKETDIPANTNYKSARTKTYYEEGIWVGYRWYNERQIKP
LFPFGHGLSYTTFEYDNLKITNQPPKNAKADEWKLEVQVDVKNTGNIPGSHSVHVYTCPP
KETETSLKHPKQTLQAFKKVSDLKPGETVTVKVILDKYAISHWDEGYNSFRAELGEWYVK
IGKDAETMIGEAKFVIEQEIEWTGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	45	257	2.8e-62	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	1.07e-64	46	371	56	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	1.11e-64	16	845	36	754	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	8.03e-52	561	730	68	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	4.12e-43	10	816	39	743	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	6.98e-36	43	262	59	289	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB76680.1|GH3	0.0	6	865	5	863
UOH84802.1|GH3	0.0	6	865	5	863
ADV23736.1|GH3	0.0	6	865	5	863
AGV14847.1|GH3	0.0	3	865	2	863
AUB28992.1|GH3	0.0	3	865	2	863

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	6.49e-218	18	865	6	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	4.15e-213	18	865	6	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	2.02e-135	14	849	1	661	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.77e-106	22	857	9	664	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	9.70e-103	18	859	4	716	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BB53|BGLI_EMENI	4.92e-235	18	865	6	839	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2
sp|Q2U8Y5|BGLI_ASPOR	9.85e-235	18	865	6	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	1.39e-234	18	865	6	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|Q4WU49|BGLI_ASPFU	1.08e-233	18	865	6	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	1.08e-233	18	865	6	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000002

TMHMM  Annotations     

There is no transmembrane helices in OCF70295.1.