CAZyme Information: OCF70047.1

Basic Information

• Species: Kwoniella mangrovensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella mangrovensis
• CAZyme ID: OCF70047.1
• CAZy Family: GT69
• CAZyme Description: alpha,alpha-trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
783	KI669472|CGC2	85291.84	4.5195

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KmangroviensisCBS8507	8555	1296122	133	8422

• Gene Location: location=KI669472:506810-510592(+)

Full Sequence      

MRSIIILSALHCAIAQNITQTSSISFSATPVSTTVPSPTVPLDTPVPGQGDYPPVQYLCE
DGTNTTYCPGVLLQDVQLAGIFPDSKPTNGTLNDTLAAFNALGSNVTVGQIETFVESNFK
GEGLDLEQIPIEGFNQNPAILDNISDPIYKAWTSIVNSYWTLLIRETNQSSLCNGTCDSS
LIPLNHTVVVPGGRYREIYYWDSRWIIEGLLKSELFDYAWNLLQNMMDFIDVYGYIPNGG
RKYYVNRSQPPMFIQMLDAYVKVTGNTTILERALPLASAEMQWWSNNRTFNYTSPFTGKT
LLVAHYAVNNSAPRPEGYVEDYETVTGSSPALNESAKAELYSELATGAESGWDYSSRWCK
QPVQNVSDNNPALRTLNVKAIIPVDLLSLLSGDHLLLANLYDLYSNTTGSSIPITSNSTQ
TGNSTDIVRTNSTGTSSSGNSSSSNPSPAFYHRQQAQSFSDAVLDLCWDPEKAWFYDFNT
TSNSRSNVYSPAGSWPLWQNITPNELANNESEALRFVSGARFLLGKYSGIPSVASLLYTG
LNWDFPNSWPPHLHTTIKAFETLGRHHPNATVLSNLTIPFSQVASGQLGLQESELQPQPQ
STIGNVSLQTQEAQGKPWPLALSIEYANRYLGAAFCSWYSTGGAIEGLLTQLPLSELNAT
GTYTAGQSGVMFEKFNATDTDAAGGGGEYTVQVGFGWTNGVVLWAAGEYGQYLPAPTCPM
IPIIEVTNNGNSSVYSNGTTTNGTGPIGNDTGSGNATSSLLFAGYRIPREEWKRAAAEHQ
KRH

Enzyme Prediction     

EC	3.2.1.28:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	82	567	2.8e-109	0.8594704684317719

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395961	Trehalase	1.19e-98	81	710	2	509	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
215307	PLN02567	2.03e-88	72	710	10	545	alpha,alpha-trehalase
224541	TreA	1.56e-54	72	703	61	546	Neutral trehalase [Carbohydrate transport and metabolism].
183934	treF	7.81e-49	72	711	62	548	alpha,alpha-trehalase TreF.
237326	treA	1.16e-48	60	703	35	530	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV23702.1|GH37	0.0	15	770	18	757
AAW44482.2|GH37|3.2.1.28	0.0	7	770	10	761
KGB76251.2|GH37	0.0	15	770	18	762
AFR96750.2|GH37	0.0	8	770	11	762
AUB26705.1|GH37	0.0	8	770	11	762

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7E9U_A	2.34e-51	106	710	74	555	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	2.83e-50	106	710	74	555	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]
2JG0_A	6.63e-45	70	703	15	496	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
2JF4_A	1.20e-42	70	703	15	496	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]
5Z66_A	8.22e-42	70	703	52	533	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54QZ5|TREA_DICDI	2.95e-89	67	718	54	594	Trehalase OS=Dictyostelium discoideum OX=44689 GN=treh PE=3 SV=1
sp|A8J4S9|TREA_APIME	7.83e-79	67	715	46	574	Trehalase OS=Apis mellifera OX=7460 PE=1 SV=1
sp|P19813|TREA_RABIT	5.00e-76	67	717	33	557	Trehalase OS=Oryctolagus cuniculus OX=9986 GN=TREH PE=1 SV=1
sp|Q8MMG9|TREA_PIMHY	4.23e-74	50	714	36	576	Trehalase OS=Pimpla hypochondriaca OX=135724 GN=tre1 PE=1 SV=1
sp|P32358|TREA_BOMMO	1.37e-73	67	713	27	553	Trehalase OS=Bombyx mori OX=7091 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000305	0.999671	CS pos: 15-16. Pr: 0.9697

TMHMM  Annotations     

There is no transmembrane helices in OCF70047.1.