CAZyme Information: OCF69956.1

Basic Information

• Species: Kwoniella mangrovensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella mangrovensis
• CAZyme ID: OCF69956.1
• CAZy Family: GT58
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
672		74597.58	6.4980

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KmangroviensisCBS8507	8555	1296122	133	8422

• Gene Location: location=KI669472:242484-245407(+)

Full Sequence      

MSSFLILLLVCRFLTSTRGFIVPNQRHGRQRDIDIGKRGNQAYFNPDSYILSSDFEITNV
PVCSHLLPRSCGTHQADCGIFCLGVNRSRGRGNTGLILSKESLTHTPLRRFSLNYGTIWQ
IRLTCDNAYTFSTTNANPDGYTRRIYTVNGQFPGPLIEVNQGDTLVVHVQNNLGTPQAIH
WHGLTQNGTSYMDGVPGMTQCPIPPGGSFTYEFPVTNQGGTYWWHSHYSNDLQEGIYGPL
IVHDTQEPLKRGQDYDEDRIVLVGDWWHDRAEVIVNGLISSAGYRGTVASPEPDTILING
IGEANCSSVLYPSGASCDPPARPEIPLPTDKRVRLRFINTASHSHLRVSIDGHELEVVEA
DSTAVWGPTIHELPISEAQRYSVIIDTNKGKAGDKFWLRVNQATVCQATASPQWALGVIT
YSDEQGQAGTGGNNGTWPNTKSWPDLGGSDQPCRDLDEDYSLYPRIAKDAYEKTIFTHSF
SSQFGVWTLFNGQQLTGFAVNNVSSQNIINDPILEIVEREGTFDRPYVSTVMVWEDGYMD
TVINNLDPIDHPFHIHGNDFQVVKRGAGNVTAEQVKGMNIRVSNPLRRDTLWIPGLSYAV
LRIRTDNPGVWTLHCHIGWHLAQGKLGALIVRPQDIQNNAARPSSWSNLCAGQDRNAIGP
NKRTVVSPLFPF

Enzyme Prediction     

No EC number prediction in OCF69956.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA1	137	624	4.2e-105	0.9776536312849162

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274555	ascorbase	1.89e-75	138	624	15	516	L-ascorbate oxidase, plant type. Members of this protein family are the copper-containing enzyme L-ascorbate oxidase (EC 1.10.3.3), also called ascorbase. This family is found in flowering plants, and shows greater sequence similarity to a family of laccases (EC 1.10.3.2) from plants than to other known ascorbate oxidases.
177843	PLN02191	1.50e-69	138	624	37	539	L-ascorbate oxidase
259950	CuRO_2_Diphenol_Ox	4.91e-65	259	422	1	164	The second cupredoxin domain of fungal laccase, diphenol oxidase. Diphenol oxidase belongs to the laccase family. It catalyzes the initial steps in melanin biosynthesis from diphenols. Melanin is one of the virulence factors of infectious fungi. In the pathogenesis of C. neoformans, melanin pigments have been shown to protect the fungal cells from oxidative and microbicidal activities of host defense systems. Laccase is a blue multi-copper enzyme that catalyzes the oxidation of a variety aromatic - notably phenolic and inorganic substances coupled to the reduction of molecular oxygen to water. It has been implicated in a wide spectrum of biological activities and, in particular, plays a key role in morphogenesis, development and lignin metabolism. Laccase is a multicopper oxidase (MCO) composed of three cupredoxin domains that include one mononuclear and one trinuclear copper center. The copper ions are bound in several sites: Type 1, Type 2, and/or Type 3. The ensemble of types 2 and 3 copper is called a trinuclear cluster. MCOs oxidize their substrate by accepting electrons at a mononuclear copper center and transferring them to the active site trinuclear copper center. The cupredoxin domain 2 of 3-domain MCOs has lost the ability to bind copper.
259926	CuRO_1_Diphenol_Ox	5.89e-64	129	243	3	119	The first cupredoxin domain of fungal laccase, diphenol oxidase. Diphenol oxidase belongs to the laccase family. It catalyzes the initial steps in melanin biosynthesis from diphenols. Melanin is one of the virulence factors of infectious fungi. In the pathogenesis of C. neoformans, melanin pigments have been shown to protect the fungal cells from oxidative and microbicidal activities of host defense systems. Laccase is a blue multicopper oxidase (MCO) which catalyzes the oxidation of a variety aromatic - notably phenolic and inorganic substances coupled to the reduction of molecular oxygen to water. It has been implicated in a wide spectrum of biological activities and, in particular, plays a key role in morphogenesis, development and lignin metabolism. Although MCOs have diverse functions, majority of them have three cupredoxin domain repeats that include one mononuclear and one trinuclear copper center. The copper ions are bound in several sites: Type 1, Type 2, and/or Type 3. The ensemble of types 2 and 3 copper is called a trinuclear cluster. MCOs oxidize their substrate by accepting electrons at a mononuclear copper center and transferring them to the active site trinuclear copper center. The cupredoxin domain 1 of 3-domain MCOs contains part the trinuclear copper binding site, which is located at the interface of domains 1 and 3.
215324	PLN02604	1.53e-63	137	645	37	557	oxidoreductase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXA19827.1|AA1	1.29e-198	129	664	64	592
AXA19828.1|AA1	1.29e-198	129	664	64	592
AAW44497.1|AA1	1.29e-198	129	664	64	592
AXA19844.1|AA1	1.29e-198	129	664	64	592
AXA19824.1|AA1	1.83e-198	129	664	64	592

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3V9E_A	2.35e-71	129	662	70	571	Structure of the L499M mutant of the laccase from B.aclada [Botrytis aclada]
3SQR_A	3.27e-71	129	662	70	571	Crystal structure of laccase from Botrytis aclada at 1.67 A resolution [Botrytis aclada],4X4K_A Structure of laccase from Botrytis aclada with full copper content [Botrytis aclada]
5LM8_A	6.07e-71	105	668	1	544	Crystal structure of a laccase-like multicopper oxidase McoG from from Aspergillus niger [Aspergillus niger]
5LWW_A	6.21e-71	105	668	2	545	Crystal structure of a laccase-like multicopper oxidase McoG from Aspergillus niger bound to zinc [Aspergillus niger]
5LWX_A	2.23e-69	105	668	29	572	Crystal structure of the H253D mutant of McoG from Aspergillus niger [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q55P57|LAC1_CRYNB	1.85e-198	129	664	64	592	Laccase-1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=LAC1 PE=1 SV=1
sp|J9VQZ4|LAC2_CRYNH	7.03e-196	129	665	64	593	Laccase-2 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=LAC2 PE=3 SV=2
sp|J9VY90|LAC1_CRYNH	4.41e-194	129	664	64	592	Laccase-1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=LAC1 PE=1 SV=1
sp|Q96WM9|LAC2_BOTFU	2.39e-70	129	662	71	572	Laccase-2 OS=Botryotinia fuckeliana OX=40559 GN=lcc2 PE=2 SV=1
sp|J5JH35|OPS5_BEAB2	4.06e-70	138	662	87	582	Oxidoreductase OpS5 OS=Beauveria bassiana (strain ARSEF 2860) OX=655819 GN=OpS5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000231	0.999723	CS pos: 19-20. Pr: 0.9737

TMHMM  Annotations     

There is no transmembrane helices in OCF69956.1.