CAZyme Information: OCF69545.1

Basic Information

• Species: Kwoniella mangrovensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella mangrovensis
• CAZyme ID: OCF69545.1
• CAZy Family: GT4
• CAZyme Description: glyoxal oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
686		73097.37	4.5746

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KmangroviensisCBS8507	8555	1296122	133	8422

• Gene Location: location=KI669473:1219318-1221575(+)

Full Sequence      

MIKPSRRPNRSTKKTLLSLLLASSIASTSASSNLQPKERQVRHRELSNRRHVLGERDDAA
VPGGFKIVGDSGVSAQMMFLGTEKTVYILDKAENNSMQVTNSDGLTHPAWGTTYDLTSNS
ATAMSVSSNTFCAAGLPVANGSWVVFGGNQPVTYEGVATKDANGANPYLNTDGGAAIRLL
TPCDDGNCAWQEGGDALTMSGKRWYPSVELLGDGSLIVLGGDNNGGYVSTFVQNNPTYEY
WPKKSSGGIHMDFLNYTVPVNLFPLTYLLPGGKLFLQAAYKTILYDMDTLTETPLPDMPY
AVRVYPASAATAMLPLTPANDYTVSLLFCGGSSAPFNKSSDGGAAFNVTAIPADDTCVRI
SPEDANPQYVDDDSMPEGRSMGNFIWLPDGTLWMGNGVNMGTAGYGDEKYSIGQSYGQAP
LYQPAIYNPSAPSGKRWSRDGLGESVQERMYHSSAILLPDSSILISGSNPNKDVTFEQWS
TSYEVEQWYPLWYNEERPVASGFPTSLSYGGDSWDLTYTPKSASSDPSNAKVVVIRTGFS
THAINFGQRYLELETSYTQNTDSGEVTLHVSQMPPNSNIFQPGPAMIFLTVDGVASQGKM
IMIGSGQIETQPVSAATVLPESSTTSSETKSGNSTADSSDSSNSTASSSQQNTAAKSAAS
LSAGLKLSTTIFGGIVALVGLALTVL

Enzyme Prediction     

No EC number prediction in OCF69545.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA5	59	623	1.7e-228	0.9893428063943162

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399910	Glyoxal_oxid_N	1.84e-34	114	331	51	243	Glyoxal oxidase N-terminus. This family represents the N-terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes. Glyoxal oxidase catalyzes the oxidation of aldehydes to carboxylic acids, coupled with reduction of dioxygen to hydrogen peroxide. It is an essential component of the extracellular lignin degradation pathways of the wood-rot fungus Phanerochaete chrysosporium.
401164	DUF1929	1.25e-24	504	603	3	91	Domain of unknown function (DUF1929). Members of this family adopt a secondary structure consisting of a bundle of seven, mostly antiparallel, beta-strands surrounding a hydrophobic core. The 7 strands are arranged in 2 sheets, in a Greek-key topology. Their precise function, has not, as yet, been defined, though they are mostly found in sugar-utilising enzymes, such as galactose oxidase.
199882	E_set_GO_C	3.14e-23	492	603	1	103	C-terminal Early set domain associated with the catalytic domain of galactose oxidase. E or "early" set domains are associated with the catalytic domain of galactose oxidase at the C-terminal end. Galactose oxidase is an extracellular monomeric enzyme which catalyzes the stereospecific oxidation of a broad range of primary alcohol substrates and possesses a unique mononuclear copper site essential for catalyzing a two-electron transfer reaction during the oxidation of primary alcohols to corresponding aldehydes. The second redox active center necessary for the reaction was found to be situated at a tyrosine residue. The C-terminal domain of galactose oxidase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB75661.1|AA5_1	0.0	44	683	22	662
UOH79381.1|AA5_1	0.0	44	683	22	662
AFR92540.1|AA5_1	0.0	44	634	22	614
AUB21983.1|AA5_1	0.0	44	634	22	614
KGB79344.2|AA5_1	4.77e-237	59	622	38	607

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4UNM_A	4.94e-19	199	599	253	608	Structure of Galactose Oxidase homologue from Streptomyces lividans [Streptomyces lividans],4UNM_B Structure of Galactose Oxidase homologue from Streptomyces lividans [Streptomyces lividans]
5LXZ_B	2.42e-17	199	599	242	597	W288A mutant of GlxA from Streptomyces lividans: Cu-bound form [Streptomyces lividans TK24]
5LQI_A	2.45e-17	199	599	247	602	W288A mutant of GlxA from Streptomyces lividans: apo form [Streptomyces lividans 1326],5LQI_B W288A mutant of GlxA from Streptomyces lividans: apo form [Streptomyces lividans 1326]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01772|GLOX_PHACH	2.69e-70	71	606	35	552	Aldehyde oxidase GLOX OS=Phanerodontia chrysosporium OX=2822231 GN=GLX PE=1 SV=1
sp|Q3HRQ2|GLOX_VITPS	7.63e-44	115	603	80	521	Aldehyde oxidase GLOX OS=Vitis pseudoreticulata OX=231512 GN=GLOX PE=2 SV=1
sp|Q9FYG4|GLOX1_ARATH	1.20e-38	115	603	162	614	Aldehyde oxidase GLOX1 OS=Arabidopsis thaliana OX=3702 GN=GLOX1 PE=2 SV=1
sp|D4AUF1|WSCD1_ARTBC	1.83e-37	124	620	477	922	WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07867 PE=1 SV=1
sp|A0A2H4HHY6|GLOX_ARTAN	5.29e-36	109	603	127	593	Putative aldehyde oxidase Art an 7 OS=Artemisia annua OX=35608 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.063557	0.936427	CS pos: 30-31. Pr: 0.8613

TMHMM  Annotations     

There is no transmembrane helices in OCF69545.1.