CAZyme Information: OCF68883.1

Basic Information

• Species: Kwoniella mangrovensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella mangrovensis
• CAZyme ID: OCF68883.1
• CAZy Family: GT31
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
977		110657.72	4.7646

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KmangroviensisCBS8507	8555	1296122	133	8422

• Gene Location: location=KI669474:1433775-1437352(+)

Full Sequence      

MSFLRRFSSAASSFIPSIPNAQGIPASHVPRRPTETFSRTSKAFVEEEDIDEKASRASWE
LSDNESVSSKGSGSSKSGASFATSSGASDLDKKSFDESDDSSSDESDDSILDRGGRPRDR
YDMMVRHLWNVAERQGWFRDADFDGLVSIRVKKRVLRTYPQPKNSKKGARELGRRIKEWD
AAISTLNPEVAMKITSKVVQAIMARCAEDAIEITLDVNTRIQILDDLTQLAGARKHQFAA
FVRAEACLVVWADEVETLIPSAEALEQRMIAYVWSGRHHELKLLEPEDESEDEIDEKGVD
EEGWVDRDAEREKELADADGDVDEEKVGGKEGDWEMRDRRPVMLYAPLVSGLAMILTFVF
IGSGIRNLIKEVMLDGSYARMALIATSPFGYLLSIFFCICIMGNLWQMLGPVAQCHQNSS
YYSGKAPTRMTGRLPHITIQMPVYKEGLEGVIIPTVESLKKAITTYERQGGSVNIFVFDD
GMQLWDEEEQEIRKAYYDRNNIGWTARPKHGKDGFIRKGRFKKASNMNFGNNLSLRVEEI
MDELRPAADEQSDVNWQWTDEDEREIYDEALATALEESQGIAWAAGNIRIGELILIIDSD
TRVPEDCFLDAASEFAQSPNIAIIQHESAVMQVVGHFFENGITSFTTRINTAISFCAANG
EVAPFVGHNAFLRWAAIQDAAFIDDDDGIRKCWSESHVSEDFDQALRCQMKGWSLRWASY
SNGGFQEGVSLTADDELNRWQKYAYGCSELLFHPLRKWLTKGPITPLYRSFVWADGIPLH
SKISVLAYISSYYAIACSLLLSLLNWVLIGLFDDLLDLFYLESWQVFLTCIVIFCGLSNV
SSALFQYRLNTNSLGNALVQNFKWIVFFFFFFCGMSWHLSTALCAHLTGYNMQWASTVKE
VELSHFFKEWPAMWKRFWDIWIVSWVMILGVAFMASPLVPMGYRITNFTCILPLMAQACS
HFLYPIVLNPWLLLFQF

Enzyme Prediction     

No EC number prediction in OCF68883.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	594	808	1.9e-54	0.9847715736040609

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	7.78e-47	593	796	1	183	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
133045	CESA_like	3.70e-08	439	701	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
224136	BcsA	9.12e-06	543	845	86	366	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
225494	MdoH	0.001	585	791	227	426	Membrane glycosyltransferase [Cell wall/membrane/envelope biogenesis, Carbohydrate transport and metabolism].
133043	CESA_CelA_like	0.002	435	717	1	202	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACZ81467.1|GT0	0.0	1	977	1	981
CED83368.1|GT0	0.0	119	977	167	1061
ACZ81448.1|GT0	2.89e-280	112	976	60	945
CCA68526.1|GT0	1.13e-249	119	977	4	871
SJX61509.1|GT0	1.65e-233	124	977	1	866

PDB Hits     

OCF68883.1 has no PDB hit.

Swiss-Prot Hits     

OCF68883.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000060	0.000003

TMHMM  Annotations     

Start	End
342	364
384	406
786	808
823	845
865	887
917	939
946	968