CAZyme Information: OCF68853.1

Basic Information

• Species: Kwoniella mangrovensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella mangrovensis
• CAZyme ID: OCF68853.1
• CAZy Family: GT3
• CAZyme Description: dolichyl-phosphate-mannose-protein mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
768		88087.41	9.1056

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KmangroviensisCBS8507	8555	1296122	133	8422

• Gene Location: location=KI669474:1334555-1337494(-)

Full Sequence      

MSLAPRKRRTERHDSPSGLPQTVRTYSGLEEEKRRSPRPVPPDSSIRSEYFFSWSTGLIL
TVLAFIIRFWRIGHPSQVVFDEVHFGSFASHYIRREYYFDVHPPLAKMLNGLAAWVVGFN
GDFGFEQIGDDYTSHNVPYVGMRSFCAIMGSITVPIVFGIMRESGYPVGIALLSAALVAF
DNGHITQTRLILLDAALVLFMALSLFSYVKFHQYRYQEFTNWWWFWLLSTGGWLACTLGC
KMVGLFTFLSVGAAVIWDLWEILDIKKGHSMAYVWRHFFYRVVGLILVPFLIYLSFFWIH
FKVLKYSGPGDSFMSPAFQETLAGNELLLNAQEIRYFDTVTIKHKDTKQFLHSHADHYPL
RYEDGRISSQGQQVTCYPHNDTNNHWQILPTKEIPESGRGRVVRHNDVIQLRHIVTDTIL
LTHDVASPLMPTNQEFTTIAPDDEDRKNDTMFKVVITDAHEGEPWRSLSGHFKLVHVPTK
VVLWTHPTALPDWAYGQQEVNGNKNQQDRTTSWFVEDIIADGTGNDFKNRTTHVEPKKTK
KVAFIKKFFELQILMLQHNAGLTSSHPYASTPVEWPFCLSGISFWTDSETNQQIYMIGNL
LGWWTCAISLSVFVGIVTADMLARRRGLDPIEDAIRNRLYRNTGFFLGAWAFHYFPFYLM
QRQRFLHHYLPAHLASALVAGSVLNFILVEVVNYPISYPGPKTRLRPAVRAKLGKTGWGV
VSGLLVLVLGMFLWLAPLTYALTLTGEQVNRRKLLSSWTLHFEAKKNH

Enzyme Prediction     

EC	2.4.1.109:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	60	301	2.1e-70	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	0.0	31	764	1	699	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	1.61e-81	59	304	2	244	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
406576	PMT_4TMC	1.03e-65	546	756	1	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
397103	MIR	5.39e-17	343	515	4	185	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
224720	ArnT	3.87e-08	58	308	11	234	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACZ81482.1|GT39	0.0	1	768	1	767
AUB24907.1|GT39	0.0	1	768	1	763
AFR95151.1|GT39	0.0	1	768	1	763
ABG57096.1|GT39|2.4.1.109	0.0	1	768	1	763
ADV21700.1|GT39	0.0	1	768	1	763

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	1.34e-110	60	758	56	727	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_B	8.48e-97	11	760	25	753	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59X23|PMT4_CANAL	9.08e-218	40	755	38	747	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
sp|P46971|PMT4_YEAST	4.86e-211	37	687	44	684	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1
sp|O42933|PMT4_SCHPO	1.74e-201	33	763	35	775	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
sp|Q8R2R1|POMT1_MOUSE	1.46e-113	60	685	44	682	Protein O-mannosyl-transferase 1 OS=Mus musculus OX=10090 GN=Pomt1 PE=1 SV=1
sp|F1Q8R9|POMT2_DANRE	7.23e-113	59	688	73	692	Protein O-mannosyl-transferase 2 OS=Danio rerio OX=7955 GN=pomt2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999948	0.000049

TMHMM  Annotations     

Start	End
50	72
139	161
168	185
190	209
222	239
243	265
278	300
595	617
638	660
675	697
718	740