CAZyme Information: OCF67978.1

Basic Information

• Species: Kwoniella mangrovensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella mangrovensis
• CAZyme ID: OCF67978.1
• CAZy Family: GT17
• CAZyme Description: glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
636		69684.91	4.1477

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KmangroviensisCBS8507	8555	1296122	133	8422

• Gene Location: location=KI669475:448440-451049(+)

Full Sequence      

MWNRVSLNSLCSTQSGYSQRGIEGPSNKRDSWTSQRPLLSPSPAGERMSTTVIPSESRWN
AMPPRGESSTSLLRKRSGGKNKKYGPTAQPSPPSPGVALMDTPLEGDFEDGLDPRNPAAL
GLDKTFSGDPEADDYLHNPDVDEWGAMDDRGNVFTVRGAANVGCLVILMIGIIALFAGYP
IADFYTQGSLDSKGGYNLGGINATGQIPSIRGFASMVDEDTPSDVYTRTGYDGEEYTLVF
SDEFNKDGRTFFPGDDPFFTAPDIHYWATSDFEWYEPSAATTRDGNLVLTMSQQSIQDLN
FKSAMLQSWNQLCFQYSFYLEARISLPGNTRYGGFWPGLWLFGNLGRPGYGASTDGTWPY
TYDSCDIGTLPNQTNVEGTGPEAALTSNKGQPISYLPGQRMSACTCPGEDHAGPDVSVGR
GAPEIDVLEAQVDLHVGQGVLSQSFQVAPFDEGYQYKNTTDVAHQYDTDLTSFNTYTGGV
YQEAVSSLTFVGTDIYQGTSREFGVQGVEMFTDPNDRSSGHITWVANGEKSWTMYPGAVG
ASESMQIGPRILPEEPMALVINFGMSNNFQAVDFVNLDFPAEYLIDYIRIYQRPEGRIGC
DPDDHPTADYIEKHIEAYMNPNMTIWSDTGYAMPVS

Enzyme Prediction     

No EC number prediction in OCF67978.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	242	591	7.7e-133	0.9969325153374233

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397841	SKN1	0.0	126	634	4	492	Beta-glucan synthesis-associated protein (SKN1). This family consists of the beta-glucan synthesis-associated proteins KRE6 and SKN1. Beta1,6-Glucan is a key component of the yeast cell wall, interconnecting cell wall proteins, beta1,3-glucan, and chitin. It has been postulated that the synthesis of beta1,6-glucan begins in the endoplasmic reticulum with the formation of protein-bound primer structures and that these primer structures are extended in the Golgi complex by two putative glucosyltransferases that are functionally redundant, Kre6 and Skn1. This is followed by maturation steps at the cell surface and by coupling to other cell wall macromolecules.
185689	GH16_fungal_KRE6_glucanase	2.78e-142	238	592	1	295	Saccharomyces cerevisiae KRE6 and related glucanses, member of glycosyl hydrolase family 16. KRE6 is a Saccharomyces cerevisiae glucanase that participates in the synthesis of beta-1,6-glucan, a major structural component of the cell wall. It is a golgi membrane protein required for normal beta-1,6-glucan levels in the cell wall. KRE6 is closely realted to laminarinase, a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
225182	BglS	2.25e-35	214	604	27	355	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
185693	GH16_laminarinase_like	4.62e-12	240	591	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFR94642.1|GH16_2	7.96e-262	82	634	24	580
AAW43249.1|GH16_2	7.96e-262	82	634	24	580
AUB24331.1|GH16_2	7.96e-262	82	634	24	580
UOH80559.1|GH16_2	4.00e-258	82	634	50	613
AAW43216.1|GH16_2	7.37e-258	80	634	38	591

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CRQ_A	4.69e-10	234	379	1	131	Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CRQ_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CTE_A Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans],4CTE_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans]
6JHJ_A	3.19e-09	234	352	2	116	Structure of Marine bacterial laminarinase mutant-E135A [Aquimarina],6JIA_A Marine bacterial laminarinase mutant E135A complex with laminaritetraose [Aquimarina sp.],6M6P_A Structure of Marine bacterial laminarinase mutant E135A in complex with 1,3-beta-cellotriosyl-glucose [Aquimarina sp.]
6JH5_A	5.77e-09	234	352	2	113	Structure of Marine bacterial laminarinase [Aquimarina]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32486|KRE6_YEAST	9.90e-131	5	634	94	703	Beta-glucan synthesis-associated protein KRE6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE6 PE=1 SV=2
sp|P87024|SKN1_CANAX	2.50e-125	131	634	246	730	Beta-glucan synthesis-associated protein SKN1 OS=Candida albicans OX=5476 GN=SKN1 PE=2 SV=1
sp|P33336|SKN1_YEAST	1.32e-123	131	634	257	755	Beta-glucan synthesis-associated protein SKN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKN1 PE=1 SV=1
sp|O13941|YEPB_SCHPO	5.09e-122	112	634	114	619	Uncharacterized beta-glucan synthesis-associated protein C23H3.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23H3.11c PE=3 SV=1
sp|P87023|KRE6_CANAX	2.73e-121	102	634	218	733	Beta-glucan synthesis-associated protein KRE6 OS=Candida albicans OX=5476 GN=KRE6 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000000

TMHMM  Annotations     

Start	End
159	181