CAZyme Information: OCF67977.1

Basic Information

• Species: Kwoniella mangrovensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella mangrovensis
• CAZyme ID: OCF67977.1
• CAZy Family: GT15
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
814		89475.12	5.3299

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KmangroviensisCBS8507	8555	1296122	133	8422

• Gene Location: location=KI669475:444030-447626(+)

Full Sequence      

MTKSAVIYPEAILKQLTSEEKIALLSGDDMWHTVPVPRLGVPRVRNGVRGTAWTNGAPAS
CFPSATGLGASMDVNLAHRIGEALGEECRARGVHCLLGPTTNCQRHPCGGRGFESFSEDP
YLCGHVALAWVQGVQSKKVMTSESVDFLANEQEYLRRSNNSVIDERTMHEVYLEPFRIQN
KAKPSVFILRNDFGFKGMIMSDWSGTYSSSEAVKASLDSEMPGPALMRGSSLERDIIGGK
LVPADIDECVLRVLHYVREAQQSGIDFEKEEDTINTPEVRALLREAADSAIVLLKNEHKV
LPISVSDKKKIAVIGPNARTASYAGGGSANLAPTYLVTPLQAITRHAESIGAEVKYTIGS
DSSRWTPLLTPYISHPQKGKAAGPGVQCDFYDQNPWEEDVKPLFSKFNNSAFSYFIDGIP
KEVPVRGYVSLKTMFTPDESGPWELGLGVAGQADLYIDGQKIIDNSTDQKEGLLFFNTGA
EERTGEVEVEAGKSYDIEVRFSNFKQLNAMSPYTGRRGGIRIGGKKRRDPQAEIEKAVKL
ATESDVAIVCVGTNSEWESEAYDREDMKLPPGTDDLVRAILAAKPEAIIVNQSGMPVEFP
WIDSASTVIQAFFGGNECGTAITDAIFGTINPSGKLPVTWAKVVEDFPSHEDFGHPIDTV
YSEGINVGYRYFDRKNHPKSAFPFGHGLSYTTFEFSDLIVKPEAFEAKATFTITNTGDLA
GAEVAQIYVHDLAPVVERPEHELAGLKKVLLQPGESKQVTVNLDEKSWIGRRGDYEIRVA
TSSTKIHLSKPVHLARSFKWIGLQEPQLYEPNWL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	37	182	3.3e-32	0.6666666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	5.92e-57	62	766	120	728	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	1.42e-48	291	669	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
224389	BglX	5.59e-41	29	318	48	364	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	8.47e-27	11	764	55	743	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.37e-19	62	254	88	314	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFR98487.2|GH3	0.0	1	814	1	849
AUB28642.1|GH3	0.0	1	814	1	849
ADV25102.1|GH3	0.0	1	813	1	844
KNX49905.2|GH3	0.0	1	814	1	849
UOH85351.1|GH3	0.0	1	807	1	833

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.93e-174	10	803	7	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.04e-170	10	803	7	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.25e-104	12	799	8	673	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	5.70e-82	8	805	6	674	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	1.74e-74	12	794	57	828	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U8Y5|BGLI_ASPOR	3.01e-193	10	803	7	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	1.89e-191	10	803	7	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|A1DFA8|BGLI_NEOFI	1.81e-188	10	803	7	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|Q5BB53|BGLI_EMENI	1.05e-187	13	803	10	839	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2
sp|Q0CAF5|BGLI_ASPTN	4.15e-187	10	803	7	839	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000034	0.000018

TMHMM  Annotations     

There is no transmembrane helices in OCF67977.1.