CAZyme Information: OCF67607.1

Basic Information

• Species: Kwoniella mangrovensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella mangrovensis
• CAZyme ID: OCF67607.1
• CAZy Family: GH71
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
455	KI669476|CGC4	52084.31	4.5479

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KmangroviensisCBS8507	8555	1296122	133	8422

• Gene Location: location=KI669476:711553-713318(-)

Full Sequence      

MSIITLSPNRYYRYILFLLFLIILFFTIPSLHSPSSRTISSEIPTDVCGLEESSDSCTDD
SSTTESELELELDGIKIDLGSVVSNIQESVERNGKKYDEDWYRNDLGFKIRYEDLGQYRS
ILKGIWKRYFSNDIEENHRGNKLDDILRYTNFIRSRSGVAGRQENAIPKDIYTTSMEDPD
KLPDQFDSWTKENKDHNVRFVDDNGIDDWLEEALSPASGVGKEMKWLKDEGRWGVVRSDL
FRYLVLLLNGGIYTDTDTACIRPISEWGKNPIKYQSDNPLIEALPQLLSLSSSSTHERYP
ISVEADDAPSLIVALEVDSPASNTDWRSETFVRGIQIVQWTIASKKGHPILLDVIGHALE
KVRELREAEERGWEVDDEQDILEWSGPGAFTDAVFRYLLIRYGFHPKSVSGYDKPLRVGD
VLIMPVYSFRADASEGYQGDEKVVWHGFFGRWKPT

Enzyme Prediction     

No EC number prediction in OCF67607.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	185	269	2.1e-17	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398274	Gly_transf_sug	2.62e-08	179	268	1	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
226297	OCH1	5.48e-07	234	380	144	262	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB74945.2|GT32	1.52e-111	74	453	61	435
AAW42866.2|GT32	4.70e-110	90	453	74	434
AFR94929.2|GT32	1.21e-109	74	453	65	441
AUB24663.1|GT32	1.21e-109	74	453	65	441
ADV21986.1|GT32	2.13e-91	74	453	61	415

PDB Hits     

OCF67607.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	2.35e-26	163	453	95	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	2.73e-26	235	453	209	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	6.46e-20	235	430	196	362	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	2.81e-19	167	453	96	470	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999983	0.000039

TMHMM  Annotations     

Start	End
12	31