CAZyme Information: OCF67204.1

Basic Information

• Species: Kwoniella mangrovensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella mangrovensis
• CAZyme ID: OCF67204.1
• CAZy Family: GH5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359		41598.72	7.1279

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KmangroviensisCBS8507	8555	1296122	133	8422

• Gene Location: location=KI669477:964990-966543(+)

Full Sequence      

MSSEVKFSLPIPKQPLEILLPFPKQNPSEHTIQLLRKLVQKILDHKEIYSVTYSPVLCPV
YKEDGGGNNQLFTIKPHWWRNPNGEWENARSQGQAQLESVSKTIHTLALGIRHVPDPDLK
QKSIERIEKLLRVFFVDIDTRMEPQVRFSQCHPGQEPMKGNECFVIAIRYLILVDQALLV
SGSLINQGLLHQTKEWFNEQMVWMENSDQGMKAKNAEKPLGYNVILASHRQFIQGDTSSI
TLATSSFNEWFTKHPIPQDVFAEFLRHDNKRHKCLFTLEPLFMLASLTVPLHHEQGISDG
MKKYLRECVEYMARVAWFERILYGRNGQGERDAEGKEEPSGEGWENEWSARMRVMWGFI

Enzyme Prediction     

No EC number prediction in OCF67204.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL38	88	314	4.7e-20	0.8064516129032258

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398861	Alginate_lyase	9.85e-06	58	287	33	238	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEL02074.1|PL38	6.50e-13	69	313	75	332
QRY55433.1|PL38	2.06e-12	46	217	59	235
QQT33561.1|PL38	6.65e-12	46	217	59	235
QQT55505.1|PL38	6.65e-12	46	217	59	235
QNF35642.1|PL38	2.02e-11	34	213	125	315

PDB Hits     

OCF67204.1 has no PDB hit.

Swiss-Prot Hits     

OCF67204.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000000

TMHMM  Annotations     

There is no transmembrane helices in OCF67204.1.