CAZyme Information: OCF66635.1

Basic Information

• Species: Kwoniella mangrovensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella mangrovensis
• CAZyme ID: OCF66635.1
• CAZy Family: GH47
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
834		90247.02	4.9251

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KmangroviensisCBS8507	8555	1296122	133	8422

• Gene Location: location=KI669478:510990-513941(+)

Full Sequence      

MTLQFDPKAIASQLTIEEACSLLHGKDFWRLNGVPRLGVPAGLKLSDGPNGARGEDFVGG
TSSACFPAGVCLAATFDIDAARKIGNAIAEECRSKSASAILGPTVNIHRSPLGGRNFESY
SEDPVVAGNIASGYIQGVQEKGVAATIKHFICNDSELDRRVMNVQVEEKPLREIYLRPFE
IVFRQAKPKAMMTAYNKVNGEYVSDSARLINGIVREEWRAKDVLVMSDWWATYSLKEAVM
AGMDLEMPDHHFRGGKKLVKAAKEDPELADAVRERAETVLGLIQYAGGYDLPPERPETAE
DKPEHRELIQSVAASGAVLLKNKNDVLPLSTSTPIAAAGLYASEALIHGGGSASLYSHHR
VSPIEGISQRFPKATLIRGPNAYNYCPLPENNVATRPDGEYGMMVEFFQPDGTLVETRPL
SGTFLTALDRYPKGLQMGWTATMSFRLKAATSGRHTLSIASCGPAELFVNGQSLCVIVPK
EEDPNLFLMLSLHKIAKKVEYDFAAGQSYDVKINYTSNDALLYATSLPANGLHFGFAEAI
DEDKIISDAVEAAEQIGTAVLCVGHGPDYETEGFDREDISLLGRQNEFIERVADSSAKVI
VVVYAGSPIAMPWLDKVDAVIYAWFPGQELGHALADVISGEVNPSGRLPVTFPKRIEDNP
SHGNFPGENQKIAYAEGCFVGYRHYASKNIPTLFPFGSGLSYTSFSVSDLQLAGQEAFGP
GQNITVSVTVTNTGLKSGRHTVLVFVTPPEGSSRPVLSLEGFAKTQLLQPGTQEEVVISL
AEDAFSHWAGGIDGSWEIEPGNYTIQILQDAGCTSGLSQTLNIPSGWERDYALA

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	33	248	1.2e-58	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	9.66e-63	66	807	120	750	beta-glucosidase BglX.
224389	BglX	4.04e-60	26	367	47	383	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	1.91e-47	538	682	73	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	1.29e-40	2	780	46	742	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	8.09e-31	36	279	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUB26217.1|GH3	4.30e-286	108	828	3	722
AFR96312.2|GH3	4.30e-286	108	828	3	722
KGB75246.2|GH3	4.08e-257	1	666	1	623
ABU57034.1|GH3	9.61e-190	8	807	17	815
QBD75129.1|GH3	1.20e-188	10	807	8	804

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	2.00e-151	4	807	3	821	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.80e-147	4	807	3	821	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	3.13e-127	6	807	4	653	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	2.75e-100	10	807	7	698	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
5WAB_A	2.95e-99	12	807	10	648	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	3.64e-183	8	816	12	832	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|A1CA51|BGLI_ASPCL	9.95e-178	4	807	3	815	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	3.09e-176	4	807	3	815	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	8.67e-176	4	807	3	815	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	8.67e-176	4	807	3	815	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999701	0.000345

TMHMM  Annotations     

There is no transmembrane helices in OCF66635.1.