CAZyme Information: OCF66044.1

Basic Information

• Species: Kwoniella mangrovensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella mangrovensis
• CAZyme ID: OCF66044.1
• CAZy Family: GH18
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
643		73585.78	8.1812

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KmangroviensisCBS8507	8555	1296122	133	8422

• Gene Location: location=KI669480:778875-782202(+)

Full Sequence      

MPRPIKTILVVSVLLILLTIHHYLPSSTLTQLKQARQSASSTSTRNTKIKSRNKVLKVKR
PPISGGWSREPYEQSGLTVDHKGLTYRTSKVKNKGYTHPIVALIERGKELAKKQKQKIDS
IQTVEDAVDDYQDKFGMKPPKGFDHWYKFTQSIKPHPIPAPSLIPLAHQPFQSFLSLPRS
VLRERIEIVRSKGAIFTLTFVPPGQGDEGTACDPSQNWIPKDYHHRGKGRVIIDGEEAWG
WRCNNTLTLLLPILSLLPEELFTMNPPLELPFSSDDGPRGMVHNTFREKAENLGRSGKVW
PINQLNKAEQSMRWTYGWSWSCPDNSPLKTRATDLVLNDLHQPDYLTGGEIEKSFIADFE
RSADYCSDPDLMNYHRAAVEMTPVVATCKTMWNSDIVGVPLDGVFEKVEYVKWEDKNIAK
AFWRGSATGLFHSRKTPWRQSQRERLHFLAHNTSASEENVSILLPNGEVGEFTRKELNGW
LDVGLSGVPAQCDQADGSCDDMAREIDFMGRVRKEDSLKYKFVIDVDGNGWSSRFRRLLS
SNNVILKSTLYPEWFHETLIPWYHYVPVKLDYTDIHDIMAFFNGSPDGKVKGHDNLAKEI
AKNGYDFVNDHWRLQDMQSFMFLLILEHWRLMSEDRQLASYDP

Enzyme Prediction     

No EC number prediction in OCF66044.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	372	632	1.7e-65	0.932

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	3.33e-25	381	635	30	256	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.59e-15	374	632	99	323	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW41853.2|GT90	2.99e-257	1	641	1	629
AUB22757.1|GT90	2.64e-252	98	641	82	635
AFR93241.2|GT90	2.64e-252	98	641	82	635
KGB74299.2|GT90	2.41e-245	73	627	59	621
UOH81501.1|GT90	4.07e-245	98	627	82	621

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	8.29e-13	437	632	206	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]
5L0R_A	2.63e-12	512	633	229	343	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	1.52e-83	55	642	115	666	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|G3V9D0|PGLT1_RAT	9.63e-13	516	633	261	371	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q16QY8|RUMI_AEDAE	4.26e-12	334	631	142	387	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|Q8T045|RUMI_DROME	4.47e-12	437	632	218	391	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1
sp|Q8NBL1|PGLT1_HUMAN	1.68e-11	512	633	257	371	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998053	0.001977

TMHMM  Annotations     

Start	End
7	24