CAZyme Information: OCF65737.1

Basic Information

• Species: Kwoniella mangrovensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella mangrovensis
• CAZyme ID: OCF65737.1
• CAZy Family: GH17
• CAZyme Description: plant-inducible protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
410		45775.15	6.2941

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KmangroviensisCBS8507	8555	1296122	133	8422

• Gene Location: location=KI669481:785201-786675(-)

Full Sequence      

MADTIAPLSLTQEKSADLISLLTDGLLHIKDQSGRFLLKLHDDTLVDTKGWEHPTVFSWE
WTHGIALTALCHHSALDPSSPGAQKSLKVALDWFETQWKRTDGKGAPKNINTMSPFYSLA
CFVEDGRTKDPKWNGWIDEWAEWIMNGLPRTEEGGFQHMTYVNMHENNLWDDTLMMSVIP
LAKIGILLNRPHYIDEAKYQFLIHIKYLADTVSGLWYHGWQFTPEKLEGGKGGAETNGGH
NFAKGLWARGNCWITVSIPMFLDILGDKLPPTDPIYRHLVSIWRRQVDAFVRSQDPRTGL
WHTLIVDPTSYVETSAAAGVVAGIYMGIRQGLISDPIYRQCADTGLAGVIAQIQPDGEVA
NVSFGTGMGHSLQFYKDIAITSMPYGQALAMHALVEWQRLQRGEGAASKA

Enzyme Prediction     

No EC number prediction in OCF65737.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	49	399	1.4e-102	0.9879518072289156

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	2.62e-77	54	400	29	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	3.08e-67	29	401	2	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUB22466.1|GH105	1.40e-207	8	405	36	456
AFR92981.1|GH105	1.40e-207	8	405	36	456
AAW41249.1|GH105	8.35e-207	8	400	37	453
KGB75254.1|GH105	7.75e-203	8	400	38	451
ADV19987.1|GH105	2.82e-202	8	400	38	451

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XUV_A	2.24e-110	19	399	12	370	Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3QWT_A	4.11e-110	18	399	29	378	Chain A, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	1.33e-100	18	399	30	379	Chain A, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4WU0_A	3.83e-11	149	350	110	299	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O31521|URHG1_BACSU	6.53e-34	57	396	27	334	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
sp|P9WF04|UH105_ALTSL	5.76e-11	170	359	201	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999569	0.000460

TMHMM  Annotations     

There is no transmembrane helices in OCF65737.1.