CAZyme Information: OCF65298.1

Basic Information

• Species: Kwoniella mangrovensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella mangrovensis
• CAZyme ID: OCF65298.1
• CAZy Family: GH16
• CAZyme Description: MIPC synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
689	KI669482|CGC3	77609.48	4.8841

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KmangroviensisCBS8507	8555	1296122	133	8422

• Gene Location: location=KI669482:287018-289423(-)

Full Sequence      

MSYSRISSSPHSTSRHDHSHSSSSKPKSTKTRKAIITLLVILSLFLIGTVIVLSSVSYFL
NIPNWAYLTESEVSWRPSDIIQPLKDPLDFNETRRIQRRKEWRDVTDDLSEAEPLEASGV
LGTETLPESWKELEEEMEQLDAAEEVDVDVDVDIPLDGDEQVEGETYDDSVESEDTMTTA
AEAAVLDDGMMQADDGVWGIDGKGTGGYWMKKDWNGKVQDTESWDRLFNVTTRPGETIPR
LIHQTWKSDVLPEKWQKAWKECREGMPDYEYMLWTDDVSREFIAKHYPAHLHMFDSYKYP
IQRADSIRYFILHHFGGVYMDLDIGCRRRLDPLLQGDWEVILPITKPVGVSNDLIFSSKG
SAFMDDTVHGLSTFDHQYFTNYPTVMFSTGPMFLSAQYALYSSAHPLTETHPRAEVRILP
KSLYGKNVPMSTVPHSFFSHFYGSSWHADDAGFITFLGAWGKKLMWVGLVVLVSGVIRLI
WLKRKAANGGQQYQLLSILPTSSSNSGGTGNGNRSGASTPTSTTGSSGGLMSPSTTFDLP
GQLQLNSSDIANVFKRAGHLILAAPATLLYGNNENRRRRQRTGLLYFVPALFQPDQVRRR
GRTASEASQLPLRTSRRDRDRAPPPPPYEPSGQDGYPMTKRDRDETMDEVDAFLNSEAEG
ETSGQSTYNDNDNDGDGEWEDWRRKSDVD

Enzyme Prediction     

No EC number prediction in OCF65298.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	254	335	6.8e-21	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	8.22e-47	219	454	65	288	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.52e-23	252	334	1	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB76679.2|GT32	2.07e-262	29	663	15	633
ADV23773.1|GT32	2.26e-259	32	663	68	683
UOH84801.1|GT32	1.15e-250	29	664	15	629
AUB28991.1|GT32	5.20e-249	33	664	68	678
AFR98795.2|GT32	5.20e-249	33	664	68	678

PDB Hits     

OCF65298.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14084|IMT1_SCHPO	5.10e-58	231	465	55	280	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q10323|IMT3_SCHPO	1.96e-55	225	457	42	265	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P33300|SUR1_YEAST	9.25e-51	236	451	53	256	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	1.46e-49	234	457	58	270	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	1.63e-47	225	454	71	289	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999989	0.000046

TMHMM  Annotations     

Start	End
34	56
464	482