CAZyme Information: OCF65049.1

Basic Information

• Species: Kwoniella mangrovensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella mangrovensis
• CAZyme ID: OCF65049.1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
709	KI669483|CGC3	80351.46	5.8172

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KmangroviensisCBS8507	8555	1296122	133	8422

• Gene Location: location=KI669483:287508-290206(+)

Full Sequence      

MVQVKINGTVNGHKTVNGVNGVNGHAKEDYSSILTRPRPQETYDLTSIEPDSFYGKLRDL
YAEKVLKTQLEQLKKQGSYDAFKLQWHPAYEVRRLYGGKARTDGIPPSLFWESDVGKWVE
AACYFLSCPDAKRFTHYEEFDGAIQELVDMIEKAQQPDGYLNIYFTVVDQEGRFKNLRDM
HEMYNAGHLLEAALAHYKYTGSRQFIDVMIRNVDCLMHHFGLADNQLHGYPGHPELELAM
LRLYSLTQDRRHLQFAKYLLEARGVKRDDQRGDTYFVWEAKHRKDEIVPPTMDTIEDVWY
HQAHEPIRDQEDVLGHSVRAFYLLTAAADLGGSFLNDAKRLWSDAVDKKMYVTGGFGTEP
RIEGFSRIPHHLPQSTGEGGCYAETCASIAVMMTSERILSHELNGKVRDVLELCLLNNTL
GGGSLKGDQFSYANKLASWGDEDVIRHDWFEVCCCPGNVSRQLGMLGGYTWSVNIDVHER
IISLDIYILLSATRNIPLPNGQSATVSMRSEMPWQGKTEWEVNAPEGWNWKLKLPNPDYA
ENVKVSEDIEERDPGFLNVALPNSSTVTQSFDMPIRLLAPHIATGQDTLTVSRGPIVYTA
EAYDNFEIEGEYKHFEGVGITSNTTFEELQETIHGIPVITLQANQPAYALNEVNQEQAYR
VVNGDHPSRSWKRLSKGLKFVPWFARGNRGGVGHLRTGFLRADEVLSQA

Enzyme Prediction     

EC	3.2.1.185:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	51	598	1.1e-129	0.9885496183206107

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226063	COG3533	2.36e-88	50	704	15	589	Uncharacterized conserved protein, DUF1680 family [Function unknown].
400342	Glyco_hydro_127	1.85e-79	51	598	6	502	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMY29319.1|GH127	3.21e-241	29	704	7	687
SMR63966.1|GH127	1.30e-240	29	704	7	687
SMQ55631.1|GH127	2.60e-240	29	704	7	687
SMR60826.1|GH127	2.60e-240	29	704	7	687
QYT01986.1|GH127	1.51e-161	39	701	4	661

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	1.63e-88	51	605	20	566	Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	3.61e-84	51	605	20	566	Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
3WKW_A	6.39e-75	109	702	72	659	Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]
3WRE_A	7.08e-75	109	697	72	654	The crystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
7EXU_A	1.71e-74	109	702	72	659	Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|E8MGH8|HYBA1_BIFL2	3.64e-74	109	697	72	654	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000003

TMHMM  Annotations     

There is no transmembrane helices in OCF65049.1.