CAZyme Information: OCF64845.1

Basic Information

• Species: Kwoniella mangrovensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella mangrovensis
• CAZyme ID: OCF64845.1
• CAZy Family: GH152
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
465		48544.04	4.1747

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KmangroviensisCBS8507	8555	1296122	133	8422

• Gene Location: location=KV700049:370432-372136(-)

Full Sequence      

MFYIRLFTLLLPLSTYATPLHLTAKQDPVPTVANIANEYGHNPCASPTDVAQSWLCEHPE
ISTAPVDTATVIQGNYGTVNPETVSSPSATASEVDGGPSEPVQPSTSPSDLAAVAASHSL
PNSGSSAATRTVGVQPTQPTTPVSSVPIAPTESTHPSTSVIEDGYTITSSQSSEGTIPNE
PSSTIAEQSSAAIQSTSSTSSSNSTTASPSECGCGYTFSQNFNSAYYPKAKIIDFSTIAD
GTDVTSLGFSTSNGDKIGASSTVTPSSICVGSSENVHISGGVLNIKVPAGQLTGGEIVFE
EAVTGGVFSMEAKIDKTEGTCQSLFTYTKTEGTADELDMEMLGKNIFKPSENGDKGIGLS
NYAPDGSKDGEHADYTSDPTADFNRYTIGWFSDSNKFYYNDQQLKGPQPHLPVNPSSIII
NNWSNGDPTFTAGPPAQDNILQSGWTVLAKADVQLWHQAGPSAIH

Enzyme Prediction     

No EC number prediction in OCF64845.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	303	441	1.8e-22	0.7447916666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	1.14e-19	274	442	30	203	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	9.09e-13	269	443	27	203	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
395585	Glyco_hydro_16	1.07e-11	271	433	1	160	Glycosyl hydrolases family 16.
215130	PLN02217	9.28e-07	71	173	561	662	probable pectinesterase/pectinesterase inhibitor
411474	fibronec_FbpA	2.46e-04	57	192	176	305	LPXTG-anchored fibronectin-binding protein FbpA. FbpA, a fibronectin-binding protein described in Streptococcus pyogenes, has a YSIRK-type (crosswall-targeting) signal peptide and a C-terminal LPXTG motif for covalent attachment to the cell wall. It is unrelated to the PavA-like protein from Streptococcus gordonii (see BlastRule NBR009716) that was given the identical name, so the phase LPXTG-anchored is added to the protein name for clarity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFR97245.2|GH16	4.19e-25	207	439	137	382
AUB27240.1|GH16	4.19e-25	207	439	137	382
AAW45658.2|GH16	4.29e-25	207	439	139	384
KGB76706.2|GH16	5.93e-24	207	439	127	372
UOH83268.1|GH16	2.62e-23	207	451	127	400

PDB Hits     

OCF64845.1 has no PDB hit.

Swiss-Prot Hits     

OCF64845.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000405	0.999552	CS pos: 17-18. Pr: 0.9677

TMHMM  Annotations     

There is no transmembrane helices in OCF64845.1.