CAZyme Information: OCF64811.1

Basic Information

• Species: Kwoniella mangrovensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella mangrovensis
• CAZyme ID: OCF64811.1
• CAZy Family: GH15
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
421	KV700049|CGC4	44183.17	4.2125

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KmangroviensisCBS8507	8555	1296122	133	8422

• Gene Location: location=KV700049:292222-293730(-)

Full Sequence      

MYLLPVLTLLAVTSAAPAPSKRKNCSVRSKSSDTAPAVVGALQQNDNAVVIPTGTDGVTP
YIPETVLPDSSSNSDVVMGAWDRGGWSGWNKPQSTSAGAAAPTTPPATAVASAFPVSQAV
PSVSQAQSAPVSQAAPPASQAVSSPASQSVAPPSSQVASSPASVPVSTAPSSTAVSTPSS
EGGQTGLGLDETSWSQLTNAQGLDWYWNWNYKPFEGMQAEFVACIWGEVMANEFIGSGTG
GLPQGVQYVMSFNEPDMGADVGGSNIPDVAHAASLHQQWTANVPEGVKIGAPAVARGGDV
KWFTPWVTACGGQCKYDFVPIHFYGVVVEDLFEYIKSFPAGGKPIWVTEFDCQDFSTGEV
CDEKKQTDFMDRAIAWFEGEGSVYVERWAWFGALPKFSETTFGLLDKGGALNEFGSHYLS
L

Enzyme Prediction     

No EC number prediction in OCF64811.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	199	418	5.9e-54	0.9732142857142857

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371727	Glyco_hydro_cc	8.53e-49	202	418	17	235	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.
236776	PRK10856	1.30e-06	117	218	177	279	cytoskeleton protein RodZ.
183854	PRK13042	7.58e-05	120	180	32	89	superantigen-like protein SSL4; Reviewed.
235906	PRK07003	2.28e-04	11	190	375	554	DNA polymerase III subunit gamma/tau.
273167	rad23	5.23e-04	119	180	84	142	UV excision repair protein Rad23. All proteins in this family for which functions are known are components of a multiprotein complex used for targeting nucleotide excision repair to specific parts of the genome. In humans, Rad23 complexes with the XPC protein. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW18429.1|GH128	2.99e-26	188	419	45	283
CCA70258.1|GH128	1.07e-24	195	421	2	234
QRV75528.1|GH128	3.50e-24	195	419	41	269
QRV90235.1|GH128	6.62e-24	195	419	41	269
QRW18428.1|GH128	1.55e-22	178	419	21	268

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UB0_A	2.77e-21	188	421	6	230	Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -2 and -1 subsites [Blastomyces gilchristii SLH14081]
6UAY_A	5.09e-21	188	421	37	261	Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) [Blastomyces gilchristii],6UAY_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) [Blastomyces gilchristii],6UAZ_A Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with glucose [Blastomyces gilchristii],6UAZ_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with glucose [Blastomyces gilchristii],6UB1_A Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_C Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_D Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii]
6UAQ_A	3.14e-17	185	418	24	259	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei],6UAR_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaritriose [Amycolatopsis mediterranei]
6UAX_A	3.93e-17	203	420	115	344	Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56],6UAX_B Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56]
6UFL_A	7.89e-17	185	418	24	259	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) in the complex with laminarihexaose [Amycolatopsis mediterranei],6UFZ_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09788|ASL1_SCHPO	1.54e-22	201	420	316	530	Alkali-sensitive linkage protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=asl1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000254	0.999732	CS pos: 15-16. Pr: 0.9773

TMHMM  Annotations     

There is no transmembrane helices in OCF64811.1.