CAZyme Information: OCF64354.1

Basic Information

• Species: Kwoniella mangrovensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella mangrovensis
• CAZyme ID: OCF64354.1
• CAZy Family: GH13
• CAZyme Description: oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
451	KV700051|CGC6	50530.94	6.7162

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KmangroviensisCBS8507	8555	1296122	133	8422

• Gene Location: location=KV700051:286366-288576(-)

Full Sequence      

MSSKPQSKLLAGRVAIVGTGHRARLYTHSIAARPQLELVALCDTNSDRMDHHNGLLKEHG
RPEAKKYPAEDFNKMLENENLDILVVTTIDFTHDLYIVPAVKKGIKVLTEKPMTTDVDKC
KKILSAVEENNGSVQVLFNYRYNPVHWKVAEVIAEGKIGNVKSVHFEWLLDTVHGADYFR
RWHRYKDKSGGLMVHKSSHHFDLVNFWINSKPSSVFGMGALSFYGTEQGKRSGWARNYDR
ARGSKEAEDDPFAIHLEDDKGLKALYHDAEHVDNYHRDMNVFADDITIEDDMSVLVHYEN
GVNMTYHLTAYSPWEGYRVMFNGDQGRLELECVESTHRTAGKKGGGAEGVVHGEKALKNE
GHNKITLQKLWGEKEDVPYVWATGGHGGGDEAMLDQIFGPIPGQEDHKSPINRLSADQND
GALAMAVGLAANESFKSGKLVQIKELLGRQL

Enzyme Prediction     

No EC number prediction in OCF64354.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	13	171	1.9e-26	0.40100250626566414

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223745	MviM	2.51e-36	13	445	5	342	Predicted dehydrogenase [General function prediction only].
396129	GFO_IDH_MocA	1.83e-16	13	138	2	120	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
397161	GFO_IDH_MocA_C	8.52e-10	151	443	2	204	Oxidoreductase family, C-terminal alpha/beta domain. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
183212	PRK11579	8.68e-04	13	182	6	163	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYV32364.1|CE9	4.44e-29	13	403	396	718
QOY90270.1|GH0	8.17e-22	7	223	32	254
UPK44969.1|GH0	3.92e-18	13	219	5	202
CEA16880.1|GH0	2.20e-16	11	219	32	259
BBD45948.1|GH0	3.21e-14	14	219	38	262

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ZH8_A	3.03e-12	4	200	14	203	Crystal structure of Oxidoreductase (TM0312) from Thermotoga maritima at 2.50 A resolution [Thermotoga maritima MSB8],1ZH8_B Crystal structure of Oxidoreductase (TM0312) from Thermotoga maritima at 2.50 A resolution [Thermotoga maritima MSB8]
3Q2K_A	2.05e-10	13	216	32	227	Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_B Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_C Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_D Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_E Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_F Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_G Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_H Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_I Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_J Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_K Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_L Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_M Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_N Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_O Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_P Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I]
5A02_A	7.43e-10	15	164	10	157	Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A03_A Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A04_A Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A05_A Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A06_A Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15]
3RC7_A	1.40e-09	13	194	29	199	Crystal Structure of the Y186F mutant of KijD10, a 3-ketoreductase from Actinomadura kijaniata in complex with TDP-benzene and NADP [Actinomadura kijaniata]
3RBV_A	1.40e-09	13	194	29	199	Crystal Structure of KijD10, a 3-ketoreductase from Actinomadura kijaniata incomplex with NADP [Actinomadura kijaniata],3RC1_A Crystal Structure of KijD10, a 3-ketoreductase from Actinomadura kijaniata incomplex with NADP and TDP-benzene [Actinomadura kijaniata],3RC2_A Crystal Structure of KijD10, a 3-ketoreductase from Actinomadura kijaniata in complex with TDP-benzene and NADP; open conformation [Actinomadura kijaniata]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34371|YTET_BACSU	5.54e-63	62	450	50	426	Putative oxidoreductase YteT OS=Bacillus subtilis (strain 168) OX=224308 GN=yteT PE=2 SV=1
sp|O05389|YRBE_BACSU	3.33e-14	16	220	9	199	Uncharacterized oxidoreductase YrbE OS=Bacillus subtilis (strain 168) OX=224308 GN=yrbE PE=3 SV=2
sp|Q6M0B9|UGNO_METMP	8.74e-13	13	215	3	188	UDP-N-acetylglucosamine 3-dehydrogenase OS=Methanococcus maripaludis (strain S2 / LL) OX=267377 GN=MMP0352 PE=1 SV=1
sp|P74041|Y816_SYNY3	1.39e-12	14	215	9	202	Uncharacterized oxidoreductase sll0816 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll0816 PE=3 SV=1
sp|A6KY05|G1092_PHOV8	3.06e-12	13	195	18	194	Glycosyl hydrolase family 109 protein 2 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0611 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000000

TMHMM  Annotations     

There is no transmembrane helices in OCF64354.1.