CAZyme Information: OCF64181.1

Basic Information

• Species: Kwoniella mangrovensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella mangrovensis
• CAZyme ID: OCF64181.1
• CAZy Family: GH128
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
631	KI669484|CGC1	70340.93	6.0840

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KmangroviensisCBS8507	8555	1296122	133	8422

• Gene Location: location=KI669484:349218-351754(-)

Full Sequence      

MDPSDHPPPPSSSSSSSSTTSRRSSSEHSSTSTYYSHSPSINTFKSTHSRDKSRSINTNL
PKTFDISGAFSSISEKPHVNDINHEDLEKGSTTSYDLPKSPSLEHPTSSSFSHIPNKVPH
LHVGLRRRRILSQLLALCGLVTVLGWWILSIRESPGGIIGMGIGKNGASEHPRVVLPGII
IGSNGEIIHQPTVEEESPLPLEEEKELTHAEKMAELSKIKGPQWGLSLSSDHLLAGLRPF
PSSGQEDEDDGKPALSELGKFADQIYNLGTLDPEEYYEQMKEFAKVVFPKKIAEQLQNAL
DIYVNVKVNDHEEKKGKESWDSTKRIWQTDKTRSKVDTKEVRSWKDGQAFDEGWQWDLLT
DSDADKYVTKHLAGSRFKEIWDNLPSGILRSDTLRYLLILFEGGIYSDTDTLLLKPPSAW
GQNPKLYKDGQGWMTDIQLQRIQDGDDVDDILGKPSVVVGLEADVGDREDWFDWWPRPIQ
IVQWTLTSSPFHPIALNALLRIHHSTAKAVQWSHSVSHSIKVLRDQGRYEDAKKLAMVDV
MNEPKNGGPVGVMAWTGPGVWTDAVLSYLRVQYGLVWTDLKDLRVPLRIGDVVILPVTGF
SPGVGNFGAQGSFHHEAMVQHGFAGSWKNDE

Enzyme Prediction     

No EC number prediction in OCF64181.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	340	422	7.9e-16	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	7.82e-15	324	630	84	347	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.78e-09	375	421	41	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB75350.2|GT32	1.62e-201	85	630	2	572
ADV19938.1|GT32	7.64e-197	86	630	2	571
AAW41222.1|GT32	3.18e-196	85	630	2	572
UOH79704.1|GT32	6.39e-196	85	630	2	572
AUB22355.1|GT32	1.28e-195	85	630	2	572

PDB Hits     

OCF64181.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	4.68e-40	321	630	141	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P31755|OCH1_YEAST	3.22e-33	325	630	99	472	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q5A4E3|OCH1_CANAL	1.15e-30	384	630	165	378	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	4.06e-14	379	601	187	362	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999176	0.000860

TMHMM  Annotations     

There is no transmembrane helices in OCF64181.1.