CAZyme Information: OCF63493.1

Basic Information

• Species: Kwoniella mangrovensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella mangrovensis
• CAZyme ID: OCF63493.1
• CAZy Family: CE4
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
147		16967.51	5.5226

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KmangroviensisCBS8507	8555	1296122	133	8422

• Gene Location: location=KI669488:452401-453049(-)

Full Sequence      

MLVLWIGINDVAMHLQNPTLDIEMYMLEEILDRMYVLGLRNLVLIDVPPRRPSMSSASFM
ETISSRISQWNDLLPSRVQHWLSKPNTTSKIFSAHDVFTEIFDDPTKYRFKHEDPDKSSG
GIWVDGLHPTSQVHKVLADELEKFLSV

Enzyme Prediction     

No EC number prediction in OCF63493.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	4	141	1e-18	0.5730337078651685

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	1.43e-15	3	144	104	270	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	1.98e-06	1	141	131	311	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
395531	Lipase_GDSL	1.92e-04	1	141	81	224	GDSL-like Lipase/Acylhydrolase.
238141	SGNH_hydrolase	2.10e-04	1	144	68	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA77953.1|CE16	2.43e-19	3	146	61	206
QRV75970.1|CE16	1.37e-12	35	145	111	225
AFT91369.1|CE16	2.87e-12	5	145	148	298
QRW11544.1|CE16	1.64e-11	5	145	137	272
QRV82804.1|CE16	1.64e-11	5	145	137	272

PDB Hits     

OCF63493.1 has no PDB hit.

Swiss-Prot Hits     

OCF63493.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000020	0.000031

TMHMM  Annotations     

There is no transmembrane helices in OCF63493.1.