CAZyme Information: OCF62579.1

Basic Information

• Species: Kwoniella mangrovensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella mangrovensis
• CAZyme ID: OCF62579.1
• CAZy Family: AA14
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
430	KV700062|CGC1	49298.69	6.1924

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KmangroviensisCBS8507	8555	1296122	133	8422

• Gene Location: location=KV700062:7056-8693(-)

Full Sequence      

MAFPRFSLELYIIAVVVICVFSLIQTLRNPTLTRPSLSLLPKPDYGVNINPPDPAQSENR
HLDQAQCMERYPKLYHEADRARKWYQSKGGITKAMVDLSETDSGNARLVILNNRLYVKGF
YGGINTRTQAAMAAVYGALLTSTEPLPDIDFVIQTSDAGSGSHPRFALDREEGQRNLWLM
PDFGFFSWPEPGVGAYSEVRSKALEYEHSLGLRLDNHLNVLHDSWENKTQKLFWRGAPMV
EVRHDLLRASKDQSWADVKELNWGAVNQDEDERKQNNGDLRTPAEHCQYAFLAQVEGWAY
SGRLKYLQQCRSVIVAHPLRYIQHYHHLFNVRDDDPDQNMVEVPLPLEENLAEVMEGLID
PRNVEKVRRIADNSWKMMREGYISPAANDCYYRYALRAYASVQTFQPSLEGKAVPYESFV
LMGTTQWDPH

Enzyme Prediction     

No EC number prediction in OCF62579.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	223	404	1.1e-16	0.748

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
310354	Glyco_transf_90	2.59e-25	90	414	24	334	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.
214773	CAP10	4.57e-13	145	405	1	255	Putative lipopolysaccharide-modifying enzyme.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB76195.2|GT0	7.08e-211	11	430	7	427
QSZ37094.1|GT0	7.91e-67	62	430	79	435
CAE7205608.1|GT0	3.73e-62	54	421	112	473
BCS30108.1|GT0	5.45e-62	57	421	77	443
BCS25126.1|GT0	1.21e-61	58	421	96	439

PDB Hits     

OCF62579.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7Z4H8|PLGT3_HUMAN	4.89e-06	224	409	303	478	Protein O-glucosyltransferase 3 OS=Homo sapiens OX=9606 GN=POGLUT3 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000030	0.000002

TMHMM  Annotations     

Start	End
7	24