CAZyme Information: OCF62420.1

Basic Information

• Species: Kwoniella mangrovensis
• Lineage: Basidiomycota; Tremellomycetes; ; Cryptococcaceae; Kwoniella; Kwoniella mangrovensis
• CAZyme ID: OCF62420.1
• CAZy Family: AA1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
487		53787.71	6.7331

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KmangroviensisCBS8507	8555	1296122	133	8422

• Gene Location: location=KV700073:12434-14456(+)

Full Sequence      

MYNTPAASDFDDWNQPGWSYGDLEPLIRKSIKFLSPEEPGSSPHSDEGVFHVSRGGHSVS
YGEEFAKACRLVLGDAKECENITTYRMGHGFGRQPKLITSDGKRSNVADAYLHPCLAKKL
TVVTGVTIDKVIFKGNEAVGVKVIGNNLPSASFGTNEKYTKTVKANEMVVLTCGALGSPA
VLERSGIGSAEVLKAAGVEVKVDLPGVGHDLDDHQLICPMYRATEGYYEPFDRYARGDKT
VKEPVDEEYERTGKGIAASNGFDFGMKIRPTKEEISSMGPAFEKYWKRIGADKPDKPLYS
NVILPYFYSYRPPPEGKYFCIGGFHNYPASRGSVHIRSTDPFSLPRAVSGFLTRPEDLPV
HNVFCRRLPFYEGEEPDSHPRFDPKSPARLRTSDDPNRTDKPVEEDVIPYSAEDDRVIEL
YVRENVATAYHSIGTCAMRGRDAMGVVDARLNVHGVKNLKVAAENAARIILQDLDAMNGV
RHVSAKL

Enzyme Prediction     

EC	1.1.3.13:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	1	462	5.7e-120	0.7813559322033898

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	3.00e-55	7	462	104	503	choline dehydrogenase; Validated
225186	BetA	4.71e-43	5	462	101	505	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	1.26e-32	7	462	100	458	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
366272	GMC_oxred_N	2.22e-18	1	214	37	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	3.40e-17	328	462	1	119	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW14249.1|AA3_3	1.62e-87	1	461	68	546
QRV85673.1|AA3_3	3.46e-86	1	461	68	546
QRW13540.1|AA3_3	3.73e-83	1	462	101	569
VWO96530.1|AA3_3	9.51e-83	1	462	99	564
QRW27767.1|AA3_3	1.58e-82	1	461	86	589

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6H3G_A	1.41e-83	1	460	103	590	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
6H3O_A	1.41e-83	1	460	103	590	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
5HSA_A	5.51e-74	1	461	100	603	Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_B Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_C Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_D Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_E Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_F Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_G Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_H Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5I68_A Chain A, Alcohol oxidase 1 [Komagataella pastoris]
5OC1_A	9.22e-23	6	461	98	532	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	9.25e-23	6	461	99	533	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q00922|ALOX_CANBO	2.18e-79	1	462	100	604	Alcohol oxidase OS=Candida boidinii OX=5477 GN=AOD1 PE=1 SV=1
sp|P04841|ALOX_PICAN	7.30e-75	1	462	101	605	Alcohol oxidase OS=Pichia angusta OX=870730 GN=MOX PE=1 SV=1
sp|C4R702|ALOX2_KOMPG	2.83e-73	1	461	100	603	Alcohol oxidase 2 OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=AOX2 PE=3 SV=1
sp|P04842|ALOX1_KOMPG	2.83e-73	1	461	100	603	Alcohol oxidase 1 OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=AOX1 PE=1 SV=2
sp|F2QY27|ALOX1_KOMPC	2.83e-73	1	461	100	603	Alcohol oxidase 1 OS=Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) OX=981350 GN=AOX1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000000

TMHMM  Annotations     

There is no transmembrane helices in OCF62420.1.