CAZyme Information: OAX85057.1

Basic Information

• Species: Emergomyces africanus
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Emergomyces; Emergomyces africanus
• CAZyme ID: OAX85057.1
• CAZy Family: GT58
• CAZyme Description: GMC_OxRdtase_N domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1B7P825]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
679		73714.10	5.2958

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EafricanusCBS136260	8860	N/A	91	8769

• Gene Location: location=LGUA01000030:11531-13642(-)

Full Sequence      

MFFRQGLGLLALIASDVLGANLHGKRHNHIHGIYEKRQSSNTTDEYEYVVVGSGPGGGPL
ASRLALAGHKVLLIEAGDDQGDSIVYQTPALHLQSSEYEAMRWDYWVNHYPDLDRQKKDS
KFTFRKSDGQFHVGAAEPADAEPLGVLYPRAGTLGGCASHNALISIYPHKSDWLNIQTIT
GDASWAPDKMRKFFERLERARYAPNGLLGHGFEGWFETSLTDLGIVLQDLKLVSLVVAIG
TAMGNGASKLINTVAGLTEVLLSDINVDTPLRDSTEAVYQVPIAVNVPEYKRNGPREFIL
QTANAVNEDGSRKYHLDIALDTLVTNVRFDTSGSTPRAVGVDFLKGQSLYSADPRATGAR
KGTPGSVTATREVILSAGAFNSPQLLMLSGIGHKDELEKFDIPVLVDLPGVGRNLQDRYE
IGLVAKTETDFPITSKCTFLTTDPDPCLTQYLNGDSALGKGTYTTNGLAVAAVKRSSVAS
GDPDLLVSGAPAYFSGYYPGYSVKSLADARHWTWIPLKAHTRNNAGTVTLRSKNPLDMPE
INFNSFDAGVTTDGADEKDLQALVEAIEFSREIFKSVIPIQGSFTEVWPGVERANDTESL
KEFIKNEAWGHHASCTCPIGADDDPMAVLDSDFRVRGVEGLRVVDASVFPKIPGFYIAVP
TYMISEKAADVILEAAKTV

Enzyme Prediction     

No EC number prediction in OAX85057.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	45	674	5.9e-92	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.16e-65	316	673	216	532	choline dehydrogenase; Validated
225186	BetA	2.78e-58	60	677	22	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	2.95e-33	526	668	5	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	4.28e-22	316	654	235	558	Protein HOTHEAD
366272	GMC_oxred_N	1.85e-11	316	420	142	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW39616.1|AA3	2.49e-306	9	676	8	677
QMW27545.1|AA3	2.49e-306	9	676	8	677
UDD55433.1|AA3	2.49e-306	9	676	8	677
QRD81945.1|AA3	5.05e-306	39	676	23	658
QPC70482.1|AA3_2	2.85e-301	36	678	44	680

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4H7U_A	1.92e-36	45	675	40	600	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3NNE_A	1.29e-34	45	675	13	529	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	1.29e-34	45	675	13	529	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
2JBV_A	3.17e-34	45	675	13	529	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
4UDP_A	3.16e-32	46	676	6	531	Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDP_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDQ_A Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688],4UDQ_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7MF12|BETA_VIBVY	3.71e-47	46	673	5	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1
sp|Q8BJ64|CHDH_MOUSE	2.25e-46	44	672	41	573	Choline dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Chdh PE=1 SV=1
sp|Q8D3K2|BETA_VIBVU	6.26e-46	46	673	5	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1
sp|Q6UPE0|CHDH_RAT	1.52e-45	39	672	39	576	Choline dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Chdh PE=1 SV=1
sp|Q8NE62|CHDH_HUMAN	5.11e-43	40	672	35	571	Choline dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=CHDH PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.008892	0.991081	CS pos: 19-20. Pr: 0.9495

TMHMM  Annotations     

There is no transmembrane helices in OAX85057.1.