CAZyme Information: OAX84754.1

Basic Information

• Species: Emergomyces africanus
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Emergomyces; Emergomyces africanus
• CAZyme ID: OAX84754.1
• CAZy Family: GT48
• CAZyme Description: Glyco_hydro_cc domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1B7P6U4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
300		31883.28	6.6893

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EafricanusCBS136260	8860	N/A	91	8769

• Gene Location: location=LGUA01000051:7366-8268(+)

Full Sequence      

MVSFKSILVSSLLVRAVSCSPVAGHPPIVRPSAMLGPPIMAGPHPIAGPHQSPTPTPSGT
PPDTPPDTPSGKRGLAYNNPKLLSAFFQTGGPFSWSYNWASRPGGNSPNVEFVPMLWGPR
AFGSWQSDASASLAAGSAHLLAFNEPDIAEQANMSPQAAAEAYQMYMNPFAGKAKLGSPA
VSNGGPPLGLTWMANFLTACGGKCHIDFLVIHWYNGAWLVEDFKNHVSAAIALAMQYGID
KVWITEFGAHGDEGAQAQFLKEVLPWLDSNPGVERYAYFFVDQLVRGDSLSLVGKAFSAV

Enzyme Prediction     

EC	3.2.1.39:1	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	87	285	5.8e-61	0.8839285714285714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371727	Glyco_hydro_cc	8.58e-70	76	289	1	216	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS57615.1|GH128	2.49e-114	1	300	1	264
OAT07255.1|GH128|3.2.1.39|3.2.1.-	6.62e-114	1	300	1	262
QSS67360.1|GH128	2.03e-113	1	300	1	264
QSS66195.1|GH128	7.74e-111	1	300	1	264
EEQ35760.1|GH128	1.80e-84	71	287	25	240

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UB0_A	2.36e-112	70	300	2	230	Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -2 and -1 subsites [Blastomyces gilchristii SLH14081]
6UAY_A	6.88e-112	70	300	33	261	Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) [Blastomyces gilchristii],6UAY_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) [Blastomyces gilchristii],6UAZ_A Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with glucose [Blastomyces gilchristii],6UAZ_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with glucose [Blastomyces gilchristii],6UB1_A Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_C Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_D Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii]
6UAQ_A	1.94e-20	95	279	47	235	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei],6UAR_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaritriose [Amycolatopsis mediterranei]
6UFL_A	5.13e-20	95	279	47	235	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) in the complex with laminarihexaose [Amycolatopsis mediterranei],6UFZ_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei]
6UAS_A	1.35e-19	95	279	47	235	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199A mutant) from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaripentaose [Amycolatopsis mediterranei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09788|ASL1_SCHPO	5.73e-20	70	279	294	498	Alkali-sensitive linkage protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=asl1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000639	0.999339	CS pos: 19-20. Pr: 0.9634

TMHMM  Annotations     

There is no transmembrane helices in OAX84754.1.