CAZyme Information: OAX80613.1

Basic Information

• Species: Emergomyces africanus
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Emergomyces; Emergomyces africanus
• CAZyme ID: OAX80613.1
• CAZy Family: GH37
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383		44442.71	6.0929

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EafricanusCBS136260	8860	N/A	91	8769

• Gene Location: location=LGUA01000660:9265-10572(-)

Full Sequence      

MFFSHLRNFTYPHHLIDLAFLVSDSKDDTLETLTKMLHELQDDPDPKQPYGEISVIEKDF
GQKVNQDVESRHGFAAQASRRKLMAQARNWLLSATLRPTHSWVYWRDADVETAPFTILED
LMRHNKDVIVPNVWRPLPDWLGGEQPYDLNSWKESETALALADSLHEDAVIVEGYAEYAT
WRPHLAYLRDPYGDPDMEMDIDGVGGVSILAKAKVFRSGVHFPAFSFEKHAETEAFGKMA
KRMKFSVVGLPHYTIWHLYEPSLDDIRHMEEMERERKAREAEEKEKAERAQFVQEHFKDA
KDEWAKDGRAIQDILKKDEQAKTGEKKQDVNKDGNSVAKGQQQQQQQQQQQHQQKQQKQQ
QQQQRTPLAEEGSPAKPKQEGRR

Enzyme Prediction     

No EC number prediction in OAX80613.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	1	226	2.8e-108	0.8470149253731343

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	6.98e-138	1	226	38	265	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS53764.1|GT62	5.56e-202	1	317	125	441
QSS75645.1|GT62	5.56e-202	1	317	125	441
UPL03464.1|GT62	7.32e-189	1	315	134	448
APA12986.1|GT62	1.73e-188	1	313	141	453
ATZ55714.1|GT62	3.25e-188	1	317	129	445

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	2.03e-55	2	262	40	304	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32629|ANP1_YEAST	1.25e-140	1	311	98	408	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|O74745|ANP1_SCHPO	1.65e-139	1	271	115	385	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|Q00314|VAN1_CANAX	7.86e-112	1	269	112	430	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P23642|VAN1_YEAST	3.67e-110	1	269	208	523	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|P53697|MNN9_CANAL	4.08e-58	2	260	107	368	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000060	0.000000

TMHMM  Annotations     

There is no transmembrane helices in OAX80613.1.