CAZyme Information: OAX80329.1

Basic Information

• Species: Emergomyces africanus
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Emergomyces; Emergomyces africanus
• CAZyme ID: OAX80329.1
• CAZy Family: GT8
• CAZyme Description: AMPK1_CBM domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1B7NU72]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
533	LGUA01000732|CGC1	54853.71	4.9424

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EafricanusCBS136260	8860	N/A	91	8769

• Gene Location: location=LGUA01000732:8172-11186(-)

Full Sequence      

SDPTANDVYVTGTFDNWARSVKLDRTADGFRKDVPVPIGGGKMLYKFIVDGAWKIDPTAL
QEDDGHHNTNNVLLRQHIKQLPPAKDTQAPASSAKGHTPETMSGVTPEATTAALAADVPK
ESDKAPQTEIIAPGAATISSAAPGSTTAALAKDVALESKKDSTPGAFPVTPAAEPELYSV
KPIPATEGIGNPIQLQPGEPVPDPSTITSNTITSTVTTDREGYEKDASAAGFAPPGETVT
SLPVTANSTNGLAEPFVQSAGPTSTTATLAGAVPLENTNRNVNGHHEPETVANNVPETVK
ESLAKAHKEPEAAGVAAAVSEKKEVEGELLKNVEPAGAAAGDLTGGVPLVVRRSIDEAHW
TPEAAAMPAAVVEKKEVEQELLHDVKRVDATGEPAPVITAETSATAPGPTAPPAAATLAP
DVSRRNQDRSISPKSREPRAAAADTAGGPPTTEQTQPTVTTGPETTTTAQTQDPARTNSA
AIAAAAAAANTATHPATAPTEAGTTTTTDQDSKPRKKKNRASAIFSKLKEKFR

Enzyme Prediction     

No EC number prediction in OAX80329.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
199889	E_set_AMPKbeta_like_N	1.39e-20	1	73	7	78	N-terminal Early set domain, a glycogen binding domain, associated with the catalytic domain of AMP-activated protein kinase beta subunit. E or "early" set domains are associated with the catalytic domain of AMP-activated protein kinase beta subunit glycogen binding domain at the N-terminal end. AMPK is a metabolic stress sensing protein that senses AMP/ATP and has recently been found to act as a glycogen sensor as well. The protein functions as an alpha-beta-gamma heterotrimer. This N-terminal domain is the glycogen binding domain of the beta subunit. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, and isoamylase.
406865	AMPK1_CBM	1.22e-15	5	73	11	77	Glycogen recognition site of AMP-activated protein kinase. AMPK1_CBM is a family found in close association with AMPKBI pfam04739. The surface of AMPK1_CBM reveals a carbohydrate-binding pocket.
223021	PHA03247	3.52e-05	103	476	2548	2916	large tegument protein UL36; Provisional
199885	E_set_GBE_prok_N	0.005	3	57	28	88	N-terminal Early set domain associated with the catalytic domain of prokaryotic glycogen branching enzyme. This subfamily is composed of predominantly prokaryotic 1,4 alpha glucan branching enzymes, also called glycogen branching enzymes. E or "early" set domains are associated with the catalytic domain of glycogen branching enzymes at the N-terminal end. Glycogen branching enzyme catalyzes the formation of alpha-1,6 branch points in either glycogen or starch by cleavage of the alpha-1,4 glucosidic linkage, yielding a non-reducing end oligosaccharide chain, as well as the subsequent attachment of short glucosyl chains to the alpha-1,6 position. By increasing the number of non-reducing ends, glycogen is more reactive to synthesis and digestion as well as being more soluble. The N-terminal domain of the 1,4 alpha glucan branching enzyme may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
237865	PRK14951	0.005	99	204	366	475	DNA polymerase III subunits gamma and tau; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS63586.1|CBM48	6.50e-107	2	340	33	425
QSS51342.1|CBM48	2.47e-99	2	340	33	363
QSS69353.1|CBM48	1.43e-94	2	340	33	363
QGA13403.1|CBM48	8.43e-85	5	405	12	380
QKX56192.1|CBM48	2.64e-83	5	408	12	384

PDB Hits     

OAX80329.1 has no PDB hit.

Swiss-Prot Hits     

OAX80329.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

There is no transmembrane helices in OAX80329.1.