CAZyme Information: OAX80318.1

Basic Information

• Species: Emergomyces africanus
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Emergomyces; Emergomyces africanus
• CAZyme ID: OAX80318.1
• CAZy Family: GH3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
430		45619.18	5.5638

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EafricanusCBS136260	8860	N/A	91	8769

• Gene Location: location=LGUA01000735:8969-10441(+)

Full Sequence      

MKFTTSVVLTVAAAGSLAAAQPHRHNHHHHHHHHAKRAPDATEVVVVPGPTVYAYEFEGE
LIDQAAACNGIQNGSMQWADPNVSMDACAPRPSITEQPKAGEFYEKPEPTVAVAAASLEL
PKIEIPSIEIPTIEIPPIPTFTPPPPPPPPSGGNGLESDFPDGQLSCSEFPSDYGAISLS
WLGLGGWSGIQYITVKDSAVSDIRTGINGDRCKDGAMCSYACPPGYQKTQWPQTQGATGQ
SVGGLECSGGKLRLTNPSLSRKLCMKGAGGVAVKNTMSEVVAVCRTDYPGTESETIPLSS
TPGSIHELTCPDAGNYYTWKQMPTSAQYYVNPKGVSIQEGCQWGDGSRPIGNFAPINLGV
GKRDGATFISIFQNKPTTTARLNFKIEIQGDNLGGKCRYENGMFYGANGANPDGCTVEVI
SGTATYVFSE

Enzyme Prediction     

EC	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH132	155	428	3.5e-99	0.8679867986798679

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397780	SUN	5.90e-135	162	416	1	244	Beta-glucosidase (SUN family). Members of this family include Nca3, Sun4 and Sim1. This is a family of yeast proteins, involved in a diverse set of functions (DNA replication, aging, mitochondrial biogenesis and cell septation). BGLA from Candida wickerhamii has been characterized as a Beta-glucosidase EC:3.2.1.21.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS61249.1|GH132	1.06e-194	1	430	1	423
QSS57189.1|GH132	2.46e-193	1	430	1	423
QSS72024.1|GH132	4.95e-193	1	430	1	423
BCR94847.1|GH132	5.42e-149	1	428	1	424
BCS07426.1|GH132	5.42e-149	1	428	1	424

PDB Hits     

OAX80318.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WGL5|SUN1_ASPFU	6.45e-135	155	428	141	413	Secreted beta-glucosidase sun1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=sun1 PE=1 SV=1
sp|D4AM57|SUN41_ARTBC	4.67e-117	1	429	1	447	Probable secreted beta-glucosidase ARB_04747 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_04747 PE=1 SV=1
sp|B3LRC2|UTH1_YEAS1	7.69e-75	159	428	105	361	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain RM11-1a) OX=285006 GN=UTH1 PE=3 SV=1
sp|A7A003|UTH1_YEAS7	7.69e-75	159	428	105	361	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=UTH1 PE=3 SV=2
sp|B5VMJ0|UTH1_YEAS6	7.69e-75	159	428	105	361	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain AWRI1631) OX=545124 GN=UTH1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000261	0.999702	CS pos: 20-21. Pr: 0.9595

TMHMM  Annotations     

There is no transmembrane helices in OAX80318.1.