CAZyme Information: OAX80315.1

Basic Information

• Species: Emergomyces africanus
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Emergomyces; Emergomyces africanus
• CAZyme ID: OAX80315.1
• CAZy Family: GH3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
264	LGUA01000736|CGC1	28394.62	7.8506

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EafricanusCBS136260	8860	N/A	91	8769

• Gene Location: location=LGUA01000736:1609-2704(-)

Full Sequence      

MRPILRITAPFTAAFLILLSTRLVSTNPLPVPVPQAQPAPAPCAAITVISARGTTEDPGE
GRLTTIASDLANAHENSERIALDYPAYLFPYSVSLFRGIQALTGLLNTSVSSCPTTKVVL
LGYSQGAHVIGNTLCGGAFAEQGIDQRIGNKVAAIIFMADPRHVPGKSFNVGSSTKSGYP
SVASSPKFEPMYKITLKLHLSCQLFPRPESENCDVYASRMRSYCDSGDPVCDSGFEQEVH
RAVVEKYRADAVAFVNRLLFCIVP

Enzyme Prediction     

No EC number prediction in OAX80315.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	42	256	7.2e-41	0.9788359788359788

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	4.49e-36	46	259	5	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS63080.1|CE5	4.98e-103	43	259	40	231
QSS50857.1|CE5	1.84e-53	15	151	12	148
QVM10784.1|CE5	4.11e-43	43	259	30	228
AMW08145.1|CE5	2.87e-42	43	257	38	233
UQC87770.1|CE5	4.46e-40	43	255	31	223

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QOZ_A	3.50e-32	43	259	2	206	Chain A, ACETYL XYLAN ESTERASE [Trichoderma reesei],1QOZ_B Chain B, ACETYL XYLAN ESTERASE [Trichoderma reesei]
1BS9_A	9.71e-32	43	259	2	206	Acetylxylan Esterase From P. Purpurogenum Refined At 1.10 Angstroms [Talaromyces purpureogenus]
1G66_A	9.71e-32	43	259	2	206	ACETYLXYLAN ESTERASE AT 0.90 ANGSTROM RESOLUTION [Talaromyces purpureogenus]
2AXE_A	2.70e-31	43	259	2	206	Iodinated Complex Of Acetyl Xylan Esterase At 1.80 Angstroms [Talaromyces purpureogenus]
4PSC_A	1.34e-06	43	161	79	194	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O59893|AXE2_TALPU	9.84e-31	43	259	29	233	Acetylxylan esterase 2 OS=Talaromyces purpureogenus OX=1266744 GN=axe-2 PE=1 SV=1
sp|Q99034|AXE1_HYPJE	1.63e-30	43	259	33	237	Acetylxylan esterase OS=Hypocrea jecorina OX=51453 GN=axe1 PE=1 SV=1
sp|A0A2J8C362|CUTI1_VERDA	8.72e-25	43	259	25	229	Cutinase 11 OS=Verticillium dahliae OX=27337 GN=VD0003_g7577 PE=1 SV=1
sp|Q8TGB8|CUTI_MONFR	3.74e-09	43	161	31	146	Cutinase OS=Monilinia fructicola OX=38448 GN=CUT1 PE=2 SV=1
sp|A6WFI5|CUTI_KINRD	7.18e-08	43	175	36	171	Cutinase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) OX=266940 GN=cut PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.037459	0.962514	CS pos: 26-27. Pr: 0.9214

TMHMM  Annotations     

There is no transmembrane helices in OAX80315.1.