CAZyme Information: OAX79924.1

Basic Information

• Species: Emergomyces africanus
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Emergomyces; Emergomyces africanus
• CAZyme ID: OAX79924.1
• CAZy Family: GH18
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:A0A1B7NT05]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
837		91220.87	5.4688

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EafricanusCBS136260	8860	N/A	91	8769

• Gene Location: location=LGUA01000849:1212-3865(+)

Full Sequence      

MATLDVEKVISELTTDEKVALTAGVDFWHTAAVHRLGIPSLRFSDGPNGVRGTQFFNSVP
SACFPCATALGATWDTELLHQVGKLLGEECKAKGAHVLLGPTINIQRSPLGGRGFESYSE
DGVLSGTLAGHYCAGVIEENVIPTPKHFVCNDQEHERMGVDSIVTQRALREIYLKPFQIA
LKMAQPGAIMTAYNKINGIHVSEDKRIIDDILRKEWKWNGLIMSDWFGVYSTSESINAGL
DLEMPGPTRWRGSILKHAAECHKVAPHVLDERVRNLLKLANLASKSGIPENAEEKELNRS
QDQALLRHAAAQSIVLMKNENNVLPFDKNKSVAVIGPNSKITTYCGGGSATVRPYYLVSP
FQGVSAKCTSEVAFAQGVYGHKVIPDLGPLLKTTDGNPGYRFRAYNDPPGVEGREIADEL
RLVNSSALLADYRSPQIKSSTFYVDMEGTFTPNESGMYDFSVTVIGSGKLFIDGELVVDN
SKNQKLGTAFFGMATIEVFGSKELNGGQTYEVLFQFGSAPTSDIASGTPELFGPGAFRFG
GCKRLDREASIASAVDLASKHDQVVIFAGLNNDWESEGHDRESMDLPPGSDELITRILAA
NPKTVVVIQSGTPVTMPWADNAQALLQAWYGGNETGNGIADVLFGDVNPSGKLPLSFPIR
LQDNPSYLNFRSERGRVLYGEDVYVGYRYYDKTQTPVLFPFGHGLSYTTFKRSGLQIASE
GDTLTVSLTVTNSGDRAGAEVVQLYVNPSPTNSINRPPRELKGFKKIHLEAGKSADVKIE
VSKREVTSFWDEIRNAWISEKGVYGVSIEGTSNGGNDEEAALKGNFEVTETLYWTGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	31	245	7.9e-66	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.32e-78	35	827	101	763	beta-glucosidase BglX.
224389	BglX	7.95e-71	26	376	48	395	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	5.87e-60	314	707	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	4.81e-39	9	792	56	753	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	4.76e-36	35	279	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJA36818.1|GH3	0.0	1	837	1	838
BCR84884.1|GH3	0.0	1	837	1	845
QMW44618.1|GH3	0.0	1	837	1	839
QMW32588.1|GH3	0.0	1	837	1	839
QRD84089.1|GH3	0.0	1	837	1	839

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	5.59e-272	1	837	1	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.17e-266	5	837	5	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.48e-146	4	832	3	672	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	3.87e-133	10	813	9	652	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	6.16e-107	6	830	4	715	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CAF5|BGLI_ASPTN	0.0	1	837	1	839	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1
sp|B0Y8M8|BGLJ_ASPFC	0.0	6	837	14	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglJ PE=3 SV=2
sp|Q5BB53|BGLI_EMENI	0.0	1	837	1	839	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2
sp|A1CA51|BGLI_ASPCL	0.0	1	837	1	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q4WLY1|BGLJ_ASPFU	0.0	6	837	14	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglJ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999385	0.000632

TMHMM  Annotations     

There is no transmembrane helices in OAX79924.1.