CAZyme Information: OAX79750.1

Basic Information

• Species: Emergomyces africanus
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Emergomyces; Emergomyces africanus
• CAZyme ID: OAX79750.1
• CAZy Family: GH16
• CAZyme Description: CAP10 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1B7NSS5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
613		70982.30	9.1235

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EafricanusCBS136260	8860	N/A	91	8769

• Gene Location: location=LGUA01000908:389-2355(-)

Full Sequence      

MRTQRLVALLAIVCLVGLSLILLGHPVPSGRGKKNKPSFDHSGFENSDSQRQQQQQQPPP
PQGSPHDKIVGGKPHPVAQLFNNANKKFDNVLAKQSKTLKDAVDEYRRRYKMPPPPKFDV
WFKFAQKRGVRLIDEYDTIYHSLLPFWGLEPELVRSRAREVIGFDNGVIAVLIRNGKVSK
VTGGGEADMWKRTALEDMLSPFVKYIPDMDLAFNIHDEPRVVLPYDDLQRLITRAVDGAL
PRALKNAYPKNTWSPRPKDMNKGDRVDEVRITRFNRFAHQPTWTISRMSCPVDSPSRSLD
ENTPDNLTAYSYSELGFLYNTTAFSDICLTPSLRHTFGFFDRPNAFDVVHDLFPIFSQSK
VSSFQDILYPSPWYWAQKVPYDPDKDFNWDKKKEQMYWRGSTTGGFSRAGGWRRQHRQLF
VKRINGWDTTKVYERSTADGGDNTWTIKDVARRKFKDIFNVKFSHIGQCDPEDCKAQAEF
FDVVASADQQDAWQYKHLVDIDGNAFSGRYYAFLRSNSLVYKLAVFREWHDEWLRAWVHY
VPLSLRGDEHVEAVRFFAMEEEGQTLARQLAKQGKEWAYSALRNDDLEVYFFRLLLEYGR
IVDDNRENIGFSP

Enzyme Prediction     

No EC number prediction in OAX79750.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	331	602	7e-81	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	6.41e-15	350	600	28	251	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.61e-05	494	600	215	321	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS52524.1|GT90	0.0	1	613	1	618
QSS70518.1|GT90	0.0	1	613	7	624
QSS64625.1|GT90	0.0	1	613	131	743
BCR83603.1|GT90	1.36e-288	73	611	64	598
QKX56622.1|GT90	4.22e-285	1	612	298	887

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	2.89e-09	354	602	154	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]
5L0R_A	1.32e-08	331	605	95	345	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	5.03e-54	28	608	121	662	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q16QY8|RUMI_AEDAE	9.28e-12	354	602	163	388	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|B0X1Q4|RUMI_CULQU	1.61e-10	354	602	164	389	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|G3V9D0|PGLT1_RAT	1.97e-09	331	605	123	373	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|A0NDG6|RUMI_ANOGA	1.11e-08	354	602	163	386	O-glucosyltransferase rumi homolog OS=Anopheles gambiae OX=7165 GN=AGAP004267 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.643718	0.356281

TMHMM  Annotations     

Start	End
7	29