CAZyme Information: OAX79722.1

Basic Information

• Species: Emergomyces africanus
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Emergomyces; Emergomyces africanus
• CAZyme ID: OAX79722.1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
488		56165.42	5.0987

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EafricanusCBS136260	8860	N/A	91	8769

• Gene Location: location=LGUA01000917:7731-9220(+)

Full Sequence      

MDGNDRLVSGVHPSMLLQTSKRGVSGLFNYDMMKYFPRFAFFTILWLKAGAKEWLPGDTT
EDGSDYLDKASDRCDCYVVSGPEPGYFQRYKFYDFRSVSPEKTWLPNSKITKRAQNKTGN
PKKEFRKNLEETGFLDDWVIQDWSRPGSDLFPIPIRNYYENVFVLEDTTNNTTDTTYLTL
RTQRLQNHSSTAEIETYSHDYFRCSLRVRLRLHAGRNGHLEDVDYEGEDRDGDGNDDRSE
FDEEAIPSKGRNHSKLEPANFRLHPPPTGAVAGIFTYHSVNVESDIEILTADPPTHIHYS
NQPDWDPLTDLMIPGASTIAELPVPWTSWATHRLDWFPTMTRWYLNNSLQDAKNYRVPDK
PSMLALNLWSDGGEWSGNMTIGSTVLMGIEWIEVAYNTSKIDGLYTESNRTRRPRQFGAS
GKSHPEWILKDKIADEVKPRRGKPEYDSKFDGFDQNDDTDKKHLQCRVGCRVDDVETIGV
PEILWDYS

Enzyme Prediction     

No EC number prediction in OAX79722.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	136	394	4.2e-78	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	9.68e-32	124	394	2	209	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS58825.1|GH16_22	1.51e-229	33	487	1	446
QSS75565.1|GH16_22	8.71e-229	33	487	1	446
QSS53837.1|GH16_22	1.24e-228	33	487	1	446
QQK40468.1|GH16_22	4.28e-89	74	441	40	421
QGA14506.1|GH16_22	9.02e-87	68	397	38	360

PDB Hits     

OAX79722.1 has no PDB hit.

Swiss-Prot Hits     

OAX79722.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999628	0.000384

TMHMM  Annotations     

There is no transmembrane helices in OAX79722.1.