CAZyme Information: OAX77544.1

Basic Information

• Species: Emergomyces africanus
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Emergomyces; Emergomyces africanus
• CAZyme ID: OAX77544.1
• CAZy Family: AA3
• CAZyme Description: Mannan endo-1,6-alpha-mannosidase [Source:UniProtKB/TrEMBL;Acc:A0A1B7NL55]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
482		51817.04	4.3445

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EafricanusCBS136260	8860	N/A	91	8769

• Gene Location: location=LGUA01002373:603-2233(-)

Full Sequence      

MKVKQFWAVLAAAGLGTRTVTALDDDLKVNVDSIESTKAAATAIARGAVKYYKGNEPGEV
PGLLPEPYNWWQSAVLFGTLVDYRHFTGDSSYNDLAKQGLSAQMGQNHDFQPVNQSRQLT
NYVQAQWGLAAMSAAEFSFDAPGSDGPEWVDLAKAVFDTQVKRWDDKKCGGGLRAQINTN
SGPASVKDSMSNGAFFELSARLARYTKDETHANWAKKAWDWMSDVGLLTNDFKVYDSTDS
ETDCKVVDKFQWSVNVGTLLSGAVNMYNSTNGDSTWKSRVEGLLRGADMFFKNDIMIEPA
CEPNNKCNLDQKAYKAVLSRALGTTLQLAAFTNVIATPKVKASARAAVDECENENGFQMC
SFDWVDADNDHDDRDDHDDHDDHDDHDDHDDDDDDETLGEQLSALQIVLAVLAGSGDAPP
PGRQNSPGGSPGGSRGGGSGGTPTNGAPPGTSSPSAASSTMDLGLQQWGAIIGMSAVVAL
VM

Enzyme Prediction     

EC	3.2.1.101:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	31	415	2.1e-86	0.9441340782122905

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	1.18e-130	49	364	14	330	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAP74717.2|GH76	7.25e-176	5	421	4	406
ABF93408.1|GH76	7.25e-176	5	421	4	406
BCS30718.1|GH76	1.05e-111	27	366	18	360
APA11655.1|GH76	1.35e-111	1	364	1	361
ATZ53339.1|GH76	1.07e-110	1	364	1	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	2.73e-76	31	371	30	385	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6FLP9|DCW1_CANGA	5.82e-83	27	448	19	415	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|P36091|DCW1_YEAST	1.77e-82	15	448	10	418	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|O74556|YCZ2_SCHPO	4.45e-81	27	364	20	357	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q75DG6|DCW1_ASHGO	3.45e-79	27	365	22	363	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|Q5AD78|DCW1_CANAL	3.54e-75	44	419	36	395	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.056702	0.943267	CS pos: 22-23. Pr: 0.8876

TMHMM  Annotations     

There is no transmembrane helices in OAX77544.1.