CAZyme Information: OAX76987.1

Basic Information

• Species: Emergomyces africanus
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Emergomyces; Emergomyces africanus
• CAZyme ID: OAX76987.1
• CAZy Family: AA1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
331		37507.26	4.4106

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_EafricanusCBS136260	8860	N/A	91	8769

• Gene Location: location=LGUA01003748:189-1237(+)

Full Sequence      

MYLGDEDLGEDYRAQLELLPGVITRDLSQMVNDKGWELKGWAAKPFSMLLSSFREVLFVD
ADALFFQNPETLFEESQYTKTGALFFKDRRIMPESKKEWLQQILPRPISRNVMATRFWTG
ESGHMQESGVVVVDKWRHFMAMCLVCRMNGSDRDGNTDENKIGVYDMVYGDKETFWIGWE
LAGDTQYAFYDGATGIIGKVEDGSSKSKGEETLPNIDIFVHQDHPDGSQAPLEGDQKSKN
YTICAPQLLHLDTNGVPLWFNGWLLGNKYADGDQRKPAEFEVYMEEPTSPGTVDAWKLTE
SNICCLTADRTFPVEGSDQATVKMLINLAKE

Enzyme Prediction     

No EC number prediction in OAX76987.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	22	206	1.6e-40	0.7424242424242424

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	2.16e-39	5	252	38	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX47386.1|GT71	7.19e-133	1	329	332	650
SMR63378.1|GT71	5.64e-115	1	331	346	725
SMY28721.1|GT71	1.79e-113	1	331	346	726
SMR60267.1|GT71	2.53e-113	1	331	346	726
SMQ55057.1|GT71	3.56e-113	1	331	346	726

PDB Hits     

OAX76987.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59YS7|MNN14_CANAL	5.89e-18	44	297	362	597	Putative alpha-1,3-mannosyltransferase MNN14 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN14 PE=2 SV=1
sp|Q5AGA0|MNN1_CANAL	2.32e-15	44	212	466	636	Putative alpha-1,3-mannosyltransferase MNN1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN1 PE=2 SV=1
sp|Q59VL7|MNN15_CANAL	5.50e-15	40	261	375	575	Putative alpha-1,3-mannosyltransferase MNN15 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN15 PE=2 SV=2
sp|Q5APQ8|MNN12_CANAL	7.95e-14	37	213	501	679	Putative alpha-1,3-mannosyltransferase MNN12 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN12 PE=3 SV=2
sp|Q5AGA9|MNN13_CANAL	3.33e-13	44	200	437	597	Putative alpha-1,3-mannosyltransferase MNN13 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN13 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000000

TMHMM  Annotations     

There is no transmembrane helices in OAX76987.1.