CAZyme Information: OAT13684.1

Basic Information

• Species: Blastomyces gilchristii
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Blastomyces; Blastomyces gilchristii
• CAZyme ID: OAT13684.1
• CAZy Family: GT50
• CAZyme Description: proteasome activator subunit 4

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
2461		278164.01	6.9721

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BgilchristiiSLH14081	10148	559298	456	9692

• Gene Location: location=GG657476:533382-541845(+)

Full Sequence      

MRLAASSSSPPHWQWICGALLNHPLRSLSVLFVLWKLLLLLAIVASPGPGYDSSTTLLPS
IASQNASDLILLSVRAGAGSGWWPSSLLKFVRWDAIYFVSIAQRGYLFEQEWAFGYGYTR
LLSGLSSAFWGDRGSHPDSLHIALTGIGLSHVCHYLSVLSLYGLSRNVFGSGDGGRAVPL
LAAVLHTISSAGAFLSAPYGEPVFSLLNFTGFYAYVSALHDDCRGYMLARDVKFLVAGGL
FAAVTTIRSNGILSGMLFAYDAVLGLANIASSGISISQIHRMFFVILGGSLILLGVVGPQ
YRAFTTYCQNVDVRRSWCDNTIPSIYTFVQNHYWGSGEFLSYWKISNLPLFCLAAPMLVL
TGISSWWAFQSPVDFDVRYKEPGKRSEEASRAEHRRTCLSRLAIPQGVLAALVLTNSHVQ
IINRISSGYPLWYWYICYCALEYGHTFHQLFNPRFLVQGMVSIAPETLGFLNPSTSYHPS
SPLAISPFFNANMDSRERLSDHLAADFTYSGNETSRATSPGGEPVRINGVVLEDQVKEAR
NRPRTYPYFKYLPYQVEDESERQCNLEEILKHLYIAVESGDFNPGAVHWTRELKGWLSLK
FDPTREQRVKLVKFYYELSLAPGIDPNVAERFATMFMLLTKRKHYLRPVKDLILDWKPLY
REIKVFVLPSQSGLVHSTNLKRNIKTLTKLCAFAQPYFDPLELRAILEEFLPHFSASFTE
GAFVVAGLINLFLPTAPAPEDREDLLPQEYLPTYLHLWSLMNRSRTFDVTFIDLISRIAR
DALPASHIPFSEFGIFTSEQTSLVFTAILRLLEIPVGQATSTYSSAVDASSGLGMMLERD
HRKHPFTHNIARWIVMSLSPACLESEDSILSMLEGLIEAVETFFHPSNAGGWSKALSQLV
YYLADFFVMRWNMEHDEEMEVTPERRLNDALKRRFVLCLREVTFMGIYSKLGLAMNFALS
TLQSLAYLEPNLILPGALQRIYPSLQGLVEVHRTTSSLRSLQVLSRLMARTKGFRCHITT
LLGLVLPGIDANDLEKSLHSLAFIQSVCYNIPFEDLTRDRDDVNGNMLAVQWITGELERM
ENEGASVEMNYDTELTNEEEEMILRSSTTQFGEFLLSFLGRVFTLLENLPDAARVRSGSP
EENVVNTLPATLLPLLASLSPELYDQALNKIVNFVSGHVIHQARDAMAFICNAVCKVNPE
KALKALVPLLIQSIRTEIDENGAASTRTTGSDILPRDRGLIWNVSMLSMCIVHVGSAVLK
YRKELFDIAIYMQQKCKGIPTVHVSNFIHHLLLNLTVTYVIDHSLYEPDIKERGIQVEQW
GQRQDPNHLTIKWHVPQREELEFAVELFKSQAENALDQLTSLTCETPNINRDGSGKEWSD
EVTRKLVLLRLIISGMSILFDNKAASKDTSGRNCSLADLDVSMPDANDQYSNEESAEDDS
ALDGSDDSAVRQTFQYPTGYLLKEDDSLYTEIHDIRRRVGEVLHNVHRFLVEKQEDDVSC
FTPLYTAYRSWFVDVGIEKSAHVLDRVTKLLVADSQPYKVSGLRKDYPRPLLVRRANVYH
VQRLRHNAAPRPRSKLDETLLFDLAESSISLYTDIRRSAQGASESALKAIWGSRLLIIPT
LIKALQNAIKTNDYRRLKGAIYSILYSSIAKPVGRHWKYAPALIKAFIEASAVDKPSIQR
LCSGVVYQIMDYGRPLERMAVLDQGIIKSIAPKSDVQAIVNNKREIIQKKRALIEQKKAE
LSEELTDMARVSHWKMASRAAAIVIGMGLRFDYVASENLVNLIIMGSIDSHPSLRGLYSQ
TLVALFTMVDVRAVCNHKYEDYIMGVQRFPAKIQVPTQPYKRGWTEEYLASFAKPEAEYY
VDHDYPGWLVWGKTMPAYRSNVKQDIEYDELEWNVRKQMGKLCTREWFSTFFKYLKQEPR
DAYADKFRMSSAMTLLYVFELMLRDELTAATFEEIKEEIALVFEDGSDKHQHRATAEILG
ALIGSVTDTSVDKRTLVWEYAFPIVRQIFSDGLTPENSGYWTTFLHMVMQCRDPRRLWPL
VDWLTSFRLDMNSNAAFKESSKINLLHQCILDFGWHFQLEKSIVADFLAHLDHPYKGVRE
AMGHTLGAIYRTRYHESYADIDQLIQAQKEASSIGSHPYKPTKEFADTVVDIFNRLEKWR
HERSPGQQTPSSYTSGSKTVLLWLDSTLSSHECTQLLQFFPGTFTEELLHMMDVKEDQEL
QRLAYHVFRHLSNVPHPSGDDSEFVEALTRIGLTSPSWHQRLRVMINIQIMYFRRLFLLP
KADRDKLFDCIACMLEDTQPEVRSGASATLSGMIRCSPARLRTDMVLKLRDRFTKALVDN
PLPKKPRRLGSGVSSGVSTGASTPNPEHTRLVLTRHAAVLGLGALIQAFPYASPPPQWMP
GVLITLSNKAAGDPGIVGQGVKSIISEFKKTRQDTWHIDVKAFEPDQVEDLAGVLWKSYF
A

Enzyme Prediction     

No EC number prediction in OAT13684.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	31	441	3.9e-91	0.9066339066339066

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406818	BLM10_mid	0.0	873	1400	1	499	Proteasome-substrate-size regulator, mid region. The ordered regions of the yeast BLM10 or PA200 (human homolog), full-length protein encode 32 HEAT repeat (HR)-like modules, each comprising two helices joined by a turn, with adjacent repeats connected by a linker. Whereas a standard HEAT repeat is composed of ~50 residues, the BLM10 HEAT repeats are highly variable. The length of helices ranges from 8 to 35 residues, turns range from 2 to 87 residues, and linkers range from 1 to 88 residues, with the longest linker, between HR21 and HR22, containing additional secondary structures (two strands and three helices). BLM10_mid is the middle ordered region of the three in BLM10. BLM10 is found to surround the proteasome entry pore in the 1.2 MDa complex of proteasome and BLM10 to form a largely closed dome that is expected to restrict access of potential substrates. Thus Blm10 and PA200 are predominantly nuclear and stimulate the degradation of model peptides, although they do not appear to stimulate the degradation of proteins, recognize ubiquitin, or utilize ATP.
403208	DUF3437	2.16e-36	2373	2460	1	86	Domain of unknown function (DUF3437). This presumed domain is functionally uncharacterized. This domain is found in eukaryotes. This domain is typically between 142 to 163 amino acids in length.
282094	Mannosyl_trans2	9.40e-34	83	435	50	390	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
406851	BLM10_N	9.60e-31	510	585	1	81	Proteasome-substrate-size regulator, N-terminal. The ordered regions of the yeast BLM10 or PA200 (human homolog), full-length protein encode 32 HEAT repeat (HR)-like modules, each comprising two helices joined by a turn, with adjacent repeats connected by a linker. Whereas a standard HEAT repeat is composed of ~50 residues, the BLM10 HEAT repeats are highly variable. The length of helices ranges from 8 to 35 residues, turns range from 2 to 87 residues, and linkers range from 1 to 88 residues, with the longest linker, between HR21 and HR22, containing additional secondary structures (two strands and three helices). BLM10_N is the N-terminal ordered region of the three in BLM10. BLM10 is found to surround the proteasome entry pore in the 1.2 MDa complex of proteasome and BLM10 to form a largely closed dome that is expected to restrict access of potential substrates. BLM10 and PA200 are predominantly nuclear and stimulate the degradation of model peptides, although they do not appear to stimulate the degradation of proteins, recognize ubiquitin, or utilize ATP.
227829	COG5542	2.72e-16	87	435	71	362	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS49377.1|GT76	4.62e-245	1	461	1	460
QSS60603.1|GT76	1.48e-204	67	461	48	444
QGA17664.1|GT76	4.54e-116	21	464	19	451
BCR82784.1|GT76	1.57e-113	19	443	13	426
BCS01167.1|GT76	1.79e-113	3	464	1	455

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KWX_A	2.87e-93	548	2455	69	1871	cryo-EM structure of human PA200 [Homo sapiens],6KWY_c human PA200-20S complex [Homo sapiens]
6REY_c	4.51e-93	548	2455	34	1836	Human 20S-PA200 Proteasome Complex [Homo sapiens],6REY_d Human 20S-PA200 Proteasome Complex [Homo sapiens]
4V7O_A6	5.83e-59	1469	2461	23	997	Chain A6, Proteasome activator BLM10 [Saccharomyces cerevisiae],4V7O_A8 Chain A8, Proteasome activator BLM10 [Saccharomyces cerevisiae],4V7O_B5 Chain B5, Proteasome activator BLM10 [Saccharomyces cerevisiae],4V7O_B8 Chain B8, Proteasome activator BLM10 [Saccharomyces cerevisiae]
4V7O_A5	4.60e-39	588	1401	4	793	Chain A5, Proteasome activator BLM10 [Saccharomyces cerevisiae],4V7O_A7 Chain A7, Proteasome activator BLM10 [Saccharomyces cerevisiae],4V7O_B4 Chain B4, Proteasome activator BLM10 [Saccharomyces cerevisiae],4V7O_B7 Chain B7, Proteasome activator BLM10 [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UJS7|GPI18_ASPOR	7.88e-109	22	442	16	393	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	3.50e-102	22	436	27	395	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|P43583|BLM10_YEAST	1.13e-97	588	2461	242	2143	Proteasome activator BLM10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BLM10 PE=1 SV=2
sp|Q5SSW2|PSME4_MOUSE	8.60e-97	548	2455	34	1836	Proteasome activator complex subunit 4 OS=Mus musculus OX=10090 GN=Psme4 PE=1 SV=1
sp|Q14997|PSME4_HUMAN	2.32e-92	548	2455	34	1836	Proteasome activator complex subunit 4 OS=Homo sapiens OX=9606 GN=PSME4 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.986763	0.013254

TMHMM  Annotations     

Start	End
28	50
142	164
177	199
203	220
252	274
279	298
347	369