CAZyme Information: OAT09294.1

Basic Information

• Species: Blastomyces gilchristii
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Blastomyces; Blastomyces gilchristii
• CAZyme ID: OAT09294.1
• CAZy Family: GH43
• CAZyme Description: polysaccharide export protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
430		48658.54	9.3405

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BgilchristiiSLH14081	10148	559298	456	9692

• Gene Location: location=GG657457:257410-258880(+)

Full Sequence      

MLVSPRGYHRWWRALLGPIFFPRRGSSHGHISVLLTSCIAFFAVVDYLIFTASSISSPRE
STDTTVVPGIRSVYVASTHWNNEAILRSHWNAAVVELARKFGKDNIYVSVYESGSWDDSK
GALRELDQQLEELGVDRTIILDPATHEDEINKPPGREGWIDTPRGKRELRRIPYLAHMRN
RSLEPLERLVQAGRTFDKIIFLNDVIFSMTDIITLLNTRSGSYAAACSLDFGKPGLFYDT
FALRDSKGSPAFSQRYPYFSARRSRNALIAGKPIPVQSCWNGIAIFDAAPFQTSTNPLRF
RGIPDSLAKYHLEGSECCLIHYDNPLSATKGVWLNPNVRVGYNLVAYEAAAARVWPSTLD
AVLVGWWKGFFASMLDLPWRSRAVVRRVKKWAREGESFNNEKERKGNREVGLPCLIDEMQ
IIVYNGWAHV

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT69	73	325	9.2e-84	0.9874476987447699

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403053	CAP59_mtransfer	1.17e-118	73	320	2	225	Cryptococcal mannosyltransferase 1. The capsule of pathogenic fungi is a complex polysaccharide whose formation is determined by a number of enzymes including, most importantly, alpha-1,3-mannosyltransferase 1, EC:2.4.1.-.
274285	TraI_TIGR	1.78e-04	93	198	1838	1947	conjugative transfer relaxase protein TraI. This protein is a component of the relaxosome complex. In the process of conjugative plasmid transfer the realaxosome binds to the plasmid at the oriT (origin of transfer) site. The relaxase protein TraI mediates the single-strand nicking and ATP-dependent unwinding (relaxation, helicase activity) of the plasmid molecule. These two activities reside in separate domains of the protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS60954.1|GT69	1.14e-220	64	430	41	435
QSS72352.1|GT69	3.53e-177	129	430	2	319
QSS55756.1|GT69	2.98e-169	1	286	1	291
QKX55062.1|GT69	8.04e-148	73	430	59	412
CAK38741.1|GT69	2.11e-141	20	430	10	416

PDB Hits     

OAT09294.1 has no PDB hit.

Swiss-Prot Hits     

OAT09294.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999998	0.000010

TMHMM  Annotations     

There is no transmembrane helices in OAT09294.1.