CAZyme Information: OAT08760.1

Basic Information

• Species: Blastomyces gilchristii
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Blastomyces; Blastomyces gilchristii
• CAZyme ID: OAT08760.1
• CAZy Family: GH31
• CAZyme Description: capsule-associated protein CAP1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
632	GG657455|CGC1	73478.85	8.8623

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BgilchristiiSLH14081	10148	559298	456	9692

• Gene Location: location=GG657455:2073141-2075155(+)

Full Sequence      

MRTQRFVVLLAVVCLVGLSFVLLGHPVPAGRVKESGKNNPLFIPTENRPKNVDHQRQQQQ
QQQQQQQQQQQPQQQQQKQNIPHEHPITVTDKSHPVAQLFDNANRKFENVRARQSETLKD
AVEEYRRRYKMPPPPRFDAWFNFAQKRGVKLIDEYDTIYHSLLPFWGLEPQLIRTRAKEV
IGFDNGVIAVLIRSGKVSKIAGGGEGIMWKREALKNMLERFVKYLPDMDLAFNIHDEPRV
VVPYDDLQRLVLRAVDNALPKAFANASPRNSWSPRPKDLNKGDRVDEVRITRFNRFAHQP
TWTISRMSCPVDSPARSLDETAADNITAYSYSQLGFIYNTTAFSDVCLTPSLRHTFGFFD
RPNAFDVTHDLFPIFSQSKVSSFQDILYPSPWYWAQKVPYDATMDYEWDNKQEQMYWRGS
TTGGFSRAGGWRRQHRQLFVKRINGWDTAKVYERSTTAAEDNAWTLKDVARRKFKHIFNV
KFSHIGQCDPEDCKAQAEFFDVVQSAAQQDAWQYKHLVDIDGNAFSGRYYAFLQSNSLVY
KLAVFREWHDEWLRAWVHYIPLSLHGDEHVETVRYLATEKEGQAIARTLAAQGQEWAQSA
LRNDDLEVYFFRLLLEYGRIVDDNRESIGFSP

Enzyme Prediction     

No EC number prediction in OAT08760.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	350	621	5.9e-80	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	1.09e-15	369	619	28	251	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	6.57e-08	373	619	108	321	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS70518.1|GT90	0.0	1	632	7	624
QSS52524.1|GT90	0.0	1	632	1	618
QSS64625.1|GT90	0.0	1	632	131	743
BCR83603.1|GT90	3.12e-292	91	630	63	598
QGA13289.1|GT90	1.89e-281	90	632	52	590

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	6.70e-08	373	621	154	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]
5L0R_A	3.14e-07	350	624	95	345	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	2.46e-47	93	627	151	662	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q16QY8|RUMI_AEDAE	2.74e-08	373	621	163	388	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|B0X1Q4|RUMI_CULQU	6.40e-08	504	621	272	389	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q8T045|RUMI_DROME	3.54e-07	373	621	166	391	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1
sp|A0NDG6|RUMI_ANOGA	7.94e-07	373	621	163	386	O-glucosyltransferase rumi homolog OS=Anopheles gambiae OX=7165 GN=AGAP004267 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.952042	0.047989

TMHMM  Annotations     

Start	End
7	29