CAZyme Information: OAT07079.1

Basic Information

• Species: Blastomyces gilchristii
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Blastomyces; Blastomyces gilchristii
• CAZyme ID: OAT07079.1
• CAZy Family: GH17
• CAZyme Description: endo-1,3(4)-beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
932		101356.24	5.0627

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BgilchristiiSLH14081	10148	559298	456	9692

• Gene Location: location=GG657452:235079-238218(-)

Full Sequence      

MTPSMPLWLVAILIMAMLHFPAAHALPCRSNYQCVVDVDQADNLSFSPITQVPTATVAAH
GDTTGIYFTQMESDVRSYSQPFPTDISYIVFEDHIGLLHPGVPHLDSVPSAVLSSNSNCY
YKGHLCPGLPHVEETRIANWLLSPSTASLNSDISIGITIPPPPPFLESSTAGCSPPYPIT
SSKSSTLAPIVPSPSSSTPTATPSPKPPSMSGQNIFEPISRDQIPQNIPSRDDHPLKRDN
ISDTPGPVSTNKFYANFFIGSQANYGFVQPYAVGWAKGTGSVKSYGLTISHTEANQLAFG
PKNPKIPGEPVQFYINPIGIQSMILSAAEIGSSTVLTVSKPLAFSAEIILRPNRDSDSNI
TFPLVQGMGYVTGVYKDLQPAIQSSVFFRQLESAPSPKLGIFKYKVILEDNTNWLIYVTP
ADGADPRLKLENNGLINGPAGFSGTIQVAKNPNGGPGETIFDGSAGVYPVAGNITGSVVA
QDATGTYRLAWEKGGKDVDSTPLLMFALPHHVQSFDSETQGRKVDLVLRTTTKGIATAVV
ADLWTMVETDLPIDMGFAPWNPAGTSATLSRPAKQMVKDIAPNELSQDIHQQTNLNSMYF
SGKAFGKFAMVVYAVRELAQDVPLSESAFDTLKDAFATFVNNEQQWPLVYDNVWKGIVSS
GTYETGDPGLDFGNTFYNDHHFHYGYFILSAAIIGSLDPSWIDANKAWVNALVRDAANSV
SDDPLFPFSRGFDWYNGHSWAKGLFESIDGKDQESTSEDTMFAYAVKMWGKVVKDPSMEA
RGNMMLAILARSLNNYFLMKSDNVNQPPNFIGNKVTGILFENKADHTTYFGPNLEYIQGI
HMLPIIPSSAYTRHKDFVREEWDAMFSDRASTPASKVQGGWQGVLYSNLALIDPDASWNF
FAQEPFDLGKIDGGASRTWYLAYAAGLGGGPH

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	235	923	2.8e-225	0.9887459807073955

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	0.0	171	931	19	759	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	0.0	568	921	1	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	1.07e-156	234	562	1	321	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.
403340	DUF3558	0.005	171	224	4	54	Protein of unknown function (DUF3558). This family of proteins is functionally uncharacterized. This protein is found in bacteria. Proteins in this family are typically between 177 to 195 amino acids in length.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS67487.1|GH81	0.0	210	931	128	850
QSS57493.1|GH81	0.0	210	931	128	850
QSS66079.1|GH81	0.0	209	931	129	852
ABH10633.1|GH81	0.0	210	931	1	718
QRD82801.1|GH81	0.0	211	929	192	909

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	8.70e-107	212	925	5	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.57e-106	212	925	30	741	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	2.49e-103	212	925	5	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	3.95e-27	583	904	325	637	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5T49_A	3.09e-22	678	917	461	696	Chain A, BH0236 protein [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	0.0	81	926	74	901	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	2.19e-172	214	931	2	706	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	7.16e-158	214	927	46	737	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|P53753|ENG1_YEAST	2.36e-156	214	927	401	1112	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	6.73e-155	220	926	442	1140	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000205	0.999750	CS pos: 25-26. Pr: 0.9741

TMHMM  Annotations     

Start	End
7	26